KEGG   Homo sapiens (human): 5787Help
Entry
5787              CDS       T01001                                 

Gene name
PTPRB, HPTP-BETA, HPTPB, PTPB, R-PTP-BETA, VEPTP
Definition
(RefSeq) protein tyrosine phosphatase, receptor type B
  KO
K05694  
receptor-type tyrosine-protein phosphatase beta [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5787 (PTPRB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5787 (PTPRB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5787 (PTPRB)
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH5; cadherin 5, type 2, VE-cadherin [KO:K06533]
     5787 (PTPRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 1997 aa AA seqDB search
MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSS
DTLGAALCPTFRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSK
EKTTSTSLHVWWTPSSGKVTSYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYN
IAITAVSGGKRSFSVYTNGSTVPSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDKG
ILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNYRWKLVRTAPMEVSNLKVTND
GSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVPGRLYQVTVSC
VSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANE
TSLSIMWQTPVAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISG
DLKNSSSVKGRTVPAQVTDLHVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNES
ISSETSRYSFHSLKSGSLYSVVVTTVSGGISSRQVVVEGRTVPSSVSGVTVNNSGRNDYL
SVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFSSLTPGRLYTVTITTRSGKYE
NHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKNNFIQTKSIPK
SENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAF
IEGFTVPSAVKNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFE
HTFHRLEAGEQYQIMIASVSGSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAA
GVAERYDILLLTENGILLRNTSEPATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAQTE
GRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLYNPDGNLQERAQVDPLVQSFS
FQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSLWFNWSPASGD
FDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVY
GLRPGRSYQFNVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDS
DFDGYSIECRKMDTQEVEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDS
TITMIDRPPPPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFTVVVREADGSDE
LKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCD
PTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAI
EGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYD
ATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVM
VTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLI
RHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRI
LQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPI
YENVNPEYHRDPVYSRH
NT seq 5994 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccatggagccgggttggccttgtggatcacactgagcctgctgcagactgga
ctggcggagccagagagatgtaacttcaccctggcggagtccaaggcctccagccattct
gtgtctatccagtggagaattttgggctcaccctgtaactttagcctcatctatagcagt
gacaccctgggggccgcgttgtgccctacctttcggatagacaacaccacatacggatgt
aaccttcaagatttacaagcaggaaccatctataacttcaggattatttctctggatgaa
gagagaacagtggtcttgcaaacagatcctttacctcctgctaggtttggagtcagtaaa
gagaagacgacttcaaccagcttgcatgtttggtggactccttcttccggaaaagtcacc
tcatatgaggtgcaattatttgatgaaaataaccaaaagatacagggggttcaaattcaa
gaaagtacttcatggaatgaatacacttttttcaatctcactgctggtagtaaatacaat
attgccatcacagctgtttctggaggaaaacgttctttttcagtttataccaatggatca
acagtgccatctccagtgaaagatattggtatttccacaaaagccaattctctcctgatt
tcctggtcccatggttctgggaatgtggaacgataccggctgatgctaatggataaaggg
atcctagttcatggcggtgttgtggacaaacatgctacttcctatgcttttcacgggctg
acccctggctacctctacaacctcactgttatgactgaggctgcagggctgcaaaactac
aggtggaaactagtcaggacagcccccatggaagtctcaaatctgaaggtgacaaatgat
ggcagtttgacctctctaaaagtcaaatggcaaagacctcctggaaatgtggattcttac
aatatcaccctgtctcacaaagggaccatcaaggaatccagagtattagcaccttggatt
actgaaactcactttaaagagttagtccccggtcgactttatcaagttactgtcagctgt
gtctctggtgaactgtctgctcagaagatggcagtgggcagaacatttccagacaaagtt
gcaaacctggaggcaaacaataatggcaggatgaggtctcttgtagtgagctggtcgccc
cctgctggagactgggagcagtatcggatcctactcttcaatgattctgtggtgctgctc
aacatcactgtgggaaaggaagaaacacagtatgtcatggatgacacggggctcgtaccg
ggaagacagtatgaggtggaagtcattgttgagagtggaaatttgaagaattctgagcgt
tgccaaggcaggacagtccccctggctgtcctccagcttcgtgtcaaacatgccaatgaa
acctcactgagtatcatgtggcagacccctgtagcagaatgggagaaatacatcatttcc
ctagctgacagagacctcttactgatccacaagtcactctccaaagatgccaaagaattc
acttttactgacctggtgcctggacgaaaatacatggctacagtcaccagtattagtgga
gacttaaaaaattcctcttcagtaaaaggaagaacagtgcctgcccaagtgactgacttg
catgtggccaaccaaggaatgaccagtagtctgtttactaactggacccaggcacaagga
gacgtagaattttaccaagtcttactgatccatgaaaatgtggtcattaaaaatgaaagc
atctccagtgagaccagcagatacagcttccactctctcaagtccggcagcctgtactcc
gtggtggtaacaacagtgagtggagggatctcttcccgacaagtggttgtggagggaaga
acagtcccttccagtgtgagtggagtaacggtgaacaattccggtcgtaatgactacctc
agcgtttcctggctgctggcgcccggagatgtggataactatgaggtaacattgtctcat
gacggcaaggtggttcagtcccttgtcattgccaagtctgtcagagaatgttccttcagc
tccctcaccccaggccgcctctacaccgtgaccataactacaaggagtggcaagtatgaa
aatcactccttcagccaagagcggacagtgcctgacaaagtccagggagtcagtgttagc
aactcagccaggagtgactatttaagggtatcctgggtgcatgccactggagactttgat
cactatgaagtcaccattaaaaacaaaaacaacttcattcaaactaaaagcattcccaag
tcagaaaacgaatgtgtatttgttcagctagtccctggacggttgtacagtgtcactgtt
actacaaaaagtggacaatatgaagccaatgaacaagggaatgggagaacaattccagag
cctgttaaggatctaacattgcgcaacaggagcactgaggacttgcatgtgacttggtca
ggagctaatggggatgtcgaccaatatgagatccagctgctcttcaatgacatgaaagta
tttcctccttttcaccttgtaaataccgcaaccgagtatcgatttacttccctaacacca
ggccgccaatacaaaattcttgtcttgacgattagcggggatgtacagcagtcagccttc
attgagggcttcacagttcctagtgctgtcaaaaatattcacatttctcccaatggagca
acagatagcctgacggtgaactggactcctggtgggggagacgttgattcctacacggtg
tcggcattcaggcacagtcaaaaggttgactctcagactattcccaagcacgtctttgag
cacacgttccacagactggaggccggggagcagtaccagatcatgattgcctcagtcagc
gggtccctgaagaatcagataaatgtggttgggcggacagttccagcatctgtccaagga
gtaattgcagacaatgcatacagcagttattccttaatagtaagttggcaaaaagctgct
ggtgtggcagaaagatatgatatcctgcttctaactgaaaatggaatccttctgcgcaac
acatcagagccagccaccactaagcaacacaaatttgaagatctaacaccaggcaagaaa
tacaagatacagatcctaactgtcagtggaggcctctttagcaaggaagcccagactgaa
ggccgaacagtcccagcagctgtcaccgacctgaggatcacagagaactccaccaggcac
ctgtccttccgctggaccgcctcagagggggagctcagctggtacaacatctttttgtac
aacccagatgggaatctccaggagagagctcaagttgacccactagtccagagcttctct
ttccagaacttgctacaaggcagaatgtacaagatggtgattgtaactcacagtggggag
ctgtctaatgagtctttcatatttggtagaacagtcccagcctctgtgagtcatctcagg
gggtccaatcggaacacgacagacagcctttggttcaactggagtccagcctctggggac
tttgacttttatgagctgattctctataatcccaatggcacaaagaaggaaaactggaaa
gacaaggacctgacggagtggcggtttcaaggccttgttcctggaaggaagtacgtgctg
tgggtggtaactcacagtggagatctcagcaataaagtcacagcggagagcagaacagct
ccaagtcctcccagtcttatgtcatttgctgacattgcaaacacatccttggccatcacg
tggaaagggcccccagactggacagactacaacgactttgagctgcagtggttgcccaga
gatgcacttactgtcttcaacccctacaacaacagaaaatcagaaggacgcattgtgtat
ggtcttcgtccagggagatcctatcaattcaacgtcaagactgtcagtggtgattcctgg
aaaacttacagcaaaccaatttttggatctgtgaggacaaagcctgacaagatacaaaac
ctgcattgccggcctcagaactccacggccattgcctgttcttggatccctcctgattct
gactttgatggttatagtattgaatgccggaaaatggacacccaagaagttgagttttcc
agaaagctggagaaagaaaaatctctgctcaacatcatgatgctagtgccccataagagg
tacctggtgtccatcaaagtgcagtcggccggcatgaccagcgaggtggttgaagacagc
actatcacaatgatagaccgcccccctcctccacccccacacattcgtgtgaatgaaaag
gatgtgctaattagcaagtcttccatcaactttactgtcaactgcagctggttcagcgac
accaatggagctgtgaaatacttcacagtggtggtgagagaggctgatggcagtgatgag
ctgaagccagaacagcagcaccctctcccttcctacctggagtacaggcacaatgcctcc
attcgggtgtatcagactaattattttgccagcaaatgtgccgaaaatcctaacagcaac
tccaagagttttaacattaagcttggagcagagatggagagcctaggtggaaaatgcgat
cccactcagcaaaaattctgtgatggaccactgaagccacacactgcctacagaatcagc
attcgagcttttacacagctctttgatgaggacctgaaggaattcacaaagccactctat
tcagacacatttttttctttacccatcactactgaatcagagcccttgtttggagctatt
gaaggtgtgagtgctggtctgtttttaattggcatgctagtggctgttgttgccttattg
atctgcagacagaaagtgagccatggtcgagaaagaccctctgcccgtctgagcattcgt
agggatcgaccattatctgtccacttaaacctgggccagaaaggtaaccggaaaacttct
tgtccaataaaaataaatcagtttgaagggcatttcatgaagctacaggctgactccaac
taccttctatccaaggaatacgaggagttaaaagacgtgggccgaaaccagtcatgtgac
attgcactcttgccggagaatagagggaaaaatcgatacaacaatatattgccctatgat
gccacgcgagtgaagctctccaatgtagatgatgatccttgctctgactacatcaatgcc
agctacatccctggcaacaacttcagaagagaatacattgtcactcagggaccgcttcct
ggcaccaaggatgacttctggaaaatggtgtgggaacaaaacgttcacaacatcgtcatg
gtgacccagtgtgttgagaagggccgagtaaagtgtgatcattactggccagcggaccag
gattccctctactatggggacctcatcctgcagatgctctcagagtccgtcctgcctgag
tggaccatccgggagtttaagatatgcggtgaggaacagcttgatgcacacagactcatc
cgccactttcactatacggtgtggccagaccatggagtcccagaaaccacccagtctctg
atccagtttgtgagaactgtcagggactacatcaacagaagcccgggtgctgggcccact
gtggtgcactgcagtgctggtgtgggtaggactggaacctttattgcattggaccgaatc
ctccagcagttagactccaaagactctgtggacatttatggagcagtgcacgacctaaga
cttcacagggttcacatggtccagactgagtgtcagtatgtctacctacatcagtgtgta
agagatgtcctcagagcaagaaagctacggagtgaacaagaaaaccccttgtttccaatc
tatgaaaatgtgaatccagagtatcacagagatccagtctattcaaggcattga

DBGET integrated database retrieval system