KEGG   Homo sapiens (human): 5788Help
Entry
5788              CDS       T01001                                 

Gene name
PTPRC, B220, CD45, CD45R, GP180, L-CA, LCA, LY5, T200
Definition
protein tyrosine phosphatase, receptor type, C (EC:3.1.3.48)
Orthology
K06478  
receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31-q32
AA seq 87 aa AA seqDB search
MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGHLQAEEQGSQSKSPNLKSREADSSAF
SWWPKAREPLTNHWSKSKSPKAEELGV
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtatttgtggcttaaactcttggcatttggctttgcctttctggacacagaa
gtatttgtgacagggcaaagcccaacaccttcccccactggccatctgcaagctgaggag
caaggaagccaatccaagtcaccaaacctcaaaagtagggaagctgacagttcagccttc
agttggtggccaaaggcccgagagcccctcacaaaccactggagtaagtccaagagtcca
aaagctgaggaacttggagtctga

DBGET integrated database retrieval system