KEGG   Homo sapiens (human): 5788Help
Entry
5788              CDS       T01001                                 

Gene name
PTPRC, B220, CD45, CD45R, GP180, L-CA, LCA, LY5, T200
Definition
protein tyrosine phosphatase, receptor type, C (EC:3.1.3.48)
Orthology
K06478  
receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Primary immunodeficiency
Disease
H00091  
T-B+Severe combined immunodeficiencies (SCIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5788 (PTPRC)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5788 (PTPRC)
   04666 Fc gamma R-mediated phagocytosis
    5788 (PTPRC)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    5788 (PTPRC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5788 (PTPRC)
Cellular antigens [BR:hsa04090]
 Proteins
  5788 (PTPRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31-q32
AA seq 87 aa AA seqDB search
MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGHLQAEEQGSQSKSPNLKSREADSSAF
SWWPKAREPLTNHWSKSKSPKAEELGV
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtatttgtggcttaaactcttggcatttggctttgcctttctggacacagaa
gtatttgtgacagggcaaagcccaacaccttcccccactggccatctgcaagctgaggag
caaggaagccaatccaagtcaccaaacctcaaaagtagggaagctgacagttcagccttc
agttggtggccaaaggcccgagagcccctcacaaaccactggagtaagtccaagagtcca
aaagctgaggaacttggagtctga

DBGET integrated database retrieval system