KEGG   Homo sapiens (human): 581
Entry
581               CDS       T01001                                 
Symbol
BAX, BCL2L4
Name
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04722  Neurotrophin signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05417  Lipid and atherosclerosis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis (cancer)
nt06240  Transcription (cancer)
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06466  Pathways of neurodegeneration
nt06524  Apoptosis
  Element
N00098  Intrinsic apoptotic pathway
N00099  Mutation-inactivated BAX to apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00115  Mutation-inactivated TP53 to transcription
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00454  HIV Vpr to intrinsic apoptotic pathway
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00481  EBV BZLF1 to p53-mediated transcription
N00511  HTLV-1 Tax to E47-mediated transcription
N00534  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N00535  HBV HBx to p53-mediated transcription
N00938  Escherichia NleH to intrinsic apoptotic pathway
N00950  Shigella FimA to crosstalk between extrinsic and intrinsic apoptotic pathways
N00982  Mutation-caused aberrant Htt to p53-mediated transcription
N01005  Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways
N01049  Mutation-inactivated PRKN to intrinsic apoptotic pathway
N01050  Mutation-inactivated PINK1 to intrinsic apoptotic pathway
N01051  Mutation-inactivated DJ1 to intrinsic apoptotic pathway
N01135  Mutation-caused aberrant SOD1 to intrinsic apoptotic pathway
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    581 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    581 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    581 (BAX)
   04215 Apoptosis - multiple species
    581 (BAX)
   04217 Necroptosis
    581 (BAX)
   04115 p53 signaling pathway
    581 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    581 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    581 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    581 (BAX)
   05202 Transcriptional misregulation in cancer
    581 (BAX)
   05203 Viral carcinogenesis
    581 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    581 (BAX)
   05212 Pancreatic cancer
    581 (BAX)
   05225 Hepatocellular carcinoma
    581 (BAX)
   05226 Gastric cancer
    581 (BAX)
   05214 Glioma
    581 (BAX)
   05216 Thyroid cancer
    581 (BAX)
   05220 Chronic myeloid leukemia
    581 (BAX)
   05217 Basal cell carcinoma
    581 (BAX)
   05218 Melanoma
    581 (BAX)
   05213 Endometrial cancer
    581 (BAX)
   05224 Breast cancer
    581 (BAX)
   05222 Small cell lung cancer
    581 (BAX)
   05223 Non-small cell lung cancer
    581 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    581 (BAX)
   05170 Human immunodeficiency virus 1 infection
    581 (BAX)
   05161 Hepatitis B
    581 (BAX)
   05160 Hepatitis C
    581 (BAX)
   05164 Influenza A
    581 (BAX)
   05162 Measles
    581 (BAX)
   05168 Herpes simplex virus 1 infection
    581 (BAX)
   05163 Human cytomegalovirus infection
    581 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    581 (BAX)
   05169 Epstein-Barr virus infection
    581 (BAX)
   05165 Human papillomavirus infection
    581 (BAX)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    581 (BAX)
   05132 Salmonella infection
    581 (BAX)
   05131 Shigellosis
    581 (BAX)
   05152 Tuberculosis
    581 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    581 (BAX)
   05014 Amyotrophic lateral sclerosis
    581 (BAX)
   05016 Huntington disease
    581 (BAX)
   05020 Prion disease
    581 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    581 (BAX)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    581 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    581 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    581 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    581 (BAX)
   01524 Platinum drug resistance
    581 (BAX)
   01522 Endocrine resistance
    581 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    581 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    581 (BAX)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    581 (BAX)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   581 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 581
NCBI-ProteinID: NP_620116
OMIM: 600040
HGNC: 959
Ensembl: ENSG00000087088
UniProt: Q07812
Structure
Position
19:48954875..48961798
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

  All links  
Ontology (3)   
   KEGG BRITE (3)   
Pathway (50)   
   KEGG PATHWAY (50)   
Network (57)   
   KEGG NETWORK (57)   
Disease (4)   
   KEGG DISEASE (1)   
   OMIM (3)   
Genome (1)   
   KEGG GENOME (1)   
Gene (26)   
   KEGG ORTHOLOGY (1)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   HGNC (1)   
   Ensembl (1)   
   RIKEN BRC-DNA (20)   
   OC (1)   
Protein sequence (11)   
   UniProt (1)   
   SWISS-PROT (1)   
   RefSeq(pep) (9)   
DNA sequence (259)   
   RefSeq(nuc) (11)   
   GenBank (124)   
   EMBL (124)   
3D Structure (29)   
   PDB (29)   
Protein domain (1)   
   Pfam (1)   
All databases (441)   

Download RDF
DBGET integrated database retrieval system