KEGG   Homo sapiens (human): 581Help
Entry
581               CDS       T01001                                 

Gene name
BAX, BCL2L4
Definition
BCL2-associated X protein
Orthology
K02159  
apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Prion diseases
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Disease
H00020  
Colorectal cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3-q13.4
AA seq 218 aa AA seqDB search
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRLLKPPHPHHRALTTAPAPPS
LPPATPLGPWAFWSRSQWCPLPIFRSSDVVYNAFSLRV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggtgaga
ctcctcaagcctcctcacccccaccaccgcgccctcaccaccgcccctgccccaccgtcc
ctgccccccgccactcctctgggaccctgggccttctggagcaggtcacagtggtgccct
ctccccatcttcagatcatcagatgtggtctataatgcgttttccttacgtgtctga

DBGET integrated database retrieval system