KEGG   Homo sapiens (human): 581Help
Entry
581               CDS       T01001                                 

Gene name
BAX, BCL2L4
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  
apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
Sphingolipid signaling pathway
p53 signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Longevity regulating pathway
Apoptosis - multiple species
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Prion diseases
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    581 (BAX)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    581 (BAX)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    581 (BAX)
   04215 Apoptosis - multiple species
    581 (BAX)
   04115 p53 signaling pathway
    581 (BAX)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    581 (BAX)
  Aging
   04211 Longevity regulating pathway - mammal
    581 (BAX)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    581 (BAX)
   05203 Viral carcinogenesis
    581 (BAX)
   05210 Colorectal cancer
    581 (BAX)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    581 (BAX)
   05016 Huntington's disease
    581 (BAX)
   05020 Prion diseases
    581 (BAX)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    581 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    581 (BAX)
  Infectious diseases
   05152 Tuberculosis
    581 (BAX)
   05166 HTLV-I infection
    581 (BAX)
   05161 Hepatitis B
    581 (BAX)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    581 (BAX)
   01522 Endocrine resistance
    581 (BAX)
   01524 Platinum drug resistance
    581 (BAX)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    581 (BAX)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   581 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3-q13.4
AA seq 192 aa AA seqDB search
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system