KEGG   Homo sapiens (human): 581Help
Entry
581               CDS       T01001                                 

Gene name
BAX, BCL2L4
Definition
BCL2-associated X protein
Orthology
K02159  
apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Prion diseases
Tuberculosis
Hepatitis B
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    581 (BAX)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    581 (BAX)
   04115 p53 signaling pathway
    581 (BAX)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    581 (BAX)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    581 (BAX)
   05203 Viral carcinogenesis
    581 (BAX)
   05210 Colorectal cancer
    581 (BAX)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    581 (BAX)
   05016 Huntington's disease
    581 (BAX)
   05020 Prion diseases
    581 (BAX)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    581 (BAX)
  Infectious diseases
   05152 Tuberculosis
    581 (BAX)
   05166 HTLV-I infection
    581 (BAX)
   05161 Hepatitis B
    581 (BAX)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    581 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3-q13.4
AA seq 221 aa AA seqDB search
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLMSLSPGRPPLL
LWDAHVADRDHLCGGSAHRLTHHLEEDGLRPPAALDCVFPP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggggctg
cccctggccgagtcactgaagcgactgatgtccctgtctccaggacggcctcctctccta
ctttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtgctcaccgcctc
actcaccatctggaagaagatgggctgaggcccccagctgccttggactgtgtttttcct
ccataa

DBGET integrated database retrieval system