KEGG   Homo sapiens (human): 5819Help
Entry
5819              CDS       T01001                                 

Gene name
NECTIN2, CD112, HVEB, PRR2, PVRL2, PVRR2
Definition
(RefSeq) nectin cell adhesion molecule 2
  KO
K06531  
poliovirus receptor-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Adherens junction
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5819 (NECTIN2)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5819 (NECTIN2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    5819 (NECTIN2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    TIGIT; T-cell immunoreceptor with Ig and ITIM domains [KO:K16350]
     5819 (NECTIN2)
   Others
    CD226, DNAM1; CD226 antigen [KO:K06567]
     5819 (NECTIN2)
  Others
   PVRL2; poliovirus receptor-related 2 [KO:K06531]
    5819 (NECTIN2)
   PVRL3; poliovirus receptor-related 3 [KO:K06592]
    5819 (NECTIN2)
Cellular antigens [BR:hsa04090]
 Proteins
  5819 (NECTIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92692(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 538 aa AA seqDB search
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggccgctgccctcctgccgtcgagatcgccgccgacgccgctgctgtggccg
ctgctgctgctgctgctcctggaaaccggagcccaggatgtgcgagttcaagtgctaccc
gaggtgcgaggccagctcgggggcaccgtggagctgccgtgccacctgctgccacctgtt
cctggactgtacatctccctggtgacctggcagcgcccagatgcacctgcgaaccaccag
aatgtggccgccttccaccctaagatgggtcccagcttccccagcccgaagcctggcagc
gagcggctgtccttcgtctctgccaagcagagcactgggcaagacacagaggcagagctc
caggacgccacgctggccctccacgggctcacggtggaggacgagggcaactacacttgc
gagtttgccaccttccccaaggggtccgtccgagggatgacctggctcagagtcatagcc
aagcccaagaaccaagctgaggcccagaaggtcacgttcagccaggaccctacgacagtg
gccctctgcatctccaaagagggccgcccacctgcccggatctcctggctctcatccctg
gactgggaagccaaagagactcaggtgtcagggaccctggccggaactgtcactgtcacc
agccgcttcaccttggtgccctcgggccgagcagatggtgtcacggtcacctgcaaagtg
gagcatgagagcttcgaggaaccagccctgatacctgtgaccctctctgtacgctaccct
cctgaagtgtccatctccggctatgatgacaactggtacctcggccgtactgatgccacc
ctgagctgtgacgtccgcagcaacccagagcccacgggctatgactggagcacgacctca
ggcaccttcccgacctccgcagtggcccagggctcccagctggtcatccacgcagtggac
agtctgttcaataccaccttcgtctgcacagtcaccaatgccgtgggcatgggccgcgct
gagcaggtcatctttgtccgagagacccccaacacagcaggcgcaggggccacaggcggc
atcatcgggggcatcatcgccgccatcattgctactgctgtggctgccacgggcatcctt
atctgccggcagcagcggaaggagcagacgctgcagggggcagaggaggacgaagacctg
gagggacctccctcctacaagccaccgaccccaaaagcgaagctggaggcacaggagatg
ccctcccagctcttcactctgggggcctcggagcacagcccactcaagaccccctacttt
gatgctggcgcctcatgcactgagcaggaaatgcctcgataccatgagctgcccaccttg
gaagaacggtcaggacccttgcaccctggagccacaagcctggggtcccccatcccggtg
cctccagggccacctgctgtggaagacgtttccctggatctagaggatgaggagggggag
gaggaggaagagtatctggacaagatcaaccccatctatgatgctctgtcctatagcagc
ccctctgattcctaccagggcaaaggctttgtcatgtcccgggccatgtatgtgtga

DBGET integrated database retrieval system