KEGG   Homo sapiens (human): 5829Help
Entry
5829              CDS       T01001                                 

Gene name
PXN
Definition
paxillin
Orthology
K05760  
paxillin
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
VEGF signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Viral carcinogenesis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    5829 (PXN)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5829 (PXN)
  Cell communication
   04510 Focal adhesion
    5829 (PXN)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    5829 (PXN)
   04062 Chemokine signaling pathway
    5829 (PXN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5829 (PXN)
   05203 Viral carcinogenesis
    5829 (PXN)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    5829 (PXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 591 aa AA seqDB search
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPL
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacttggagtctaccacctcccacatctccaaa
cggcctgtgttcttgtcggaggagaccccctactcatacccaactggaaaccacacatac
caggagattgccgtgccaccccccgtccccccacccccgtccagcgaggccctcaatggc
acaatccttgaccccttagaccagtggcagcccagcagctcccgattcatccaccagcag
cctcagtcctcatcacctgtgtacggctccagtgccaaaacttccagtgtctccaaccct
caggacagtgttggctctccgtgctcccgagtgggtgaggaggagcacgtctacagcttc
cccaacaagcagaaatcagctgagccttcacccaccgtaatgagcacgtccctgggcagc
aacctttctgaactcgaccgcctgctgctggaactgaacgctgtacagcataacccgcca
ggcttccctgcagatgaggccaactcaagccccccgcttcctggggccctgagccccctc
tatggtgtcccagagactaacagccccttgggaggcaaagctgggcccctgacgaaagag
aagcctaagcggaatgggggccggggcctggaggacgtgcggcccagtgtggagagtctc
ttggatgaactggagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagcccgcagcgcgtcacctccacccaacagcagacacgcatctcggcctcc
tctgccaccagggagctggacgagctgatggcttcgctgtcggatttcaagatccagggc
ctggagcaaagagcggatggggagcggtgctgggcggccggctggcctcgggacggcggg
cggagcagccccggagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctcaccccctggggggcccccgaagcccgggagccagctggacagcatgctggggagc
ctgcagtctgacctgaacaagctgggggtcgccacagtcgccaaaggagtctgcggggcc
tgcaagaagcccatcgccgggcaggttgtgaccgccatggggaagacgtggcaccccgag
cacttcgtctgcacccactgccaggaggagatcggatcccggaacttcttcgagcgggat
ggacagccctactgtgaaaaggactaccacaacctcttctccccgcgctgctactactgc
aacggccccatcctggataaagtggtgacagcccttgaccggacgtggcaccctgaacac
ttcttctgtgcacagtgtggagccttctttggtcccgaagggttccacgagaaggacggc
aaggcctactgtcgcaaggactacttcgacatgttcgcacccaagtgtggcggctgcgcc
cgggccatcctggagaactatatctcagccctcaacacgctgtggcatcctgagtgcttt
gtgtgccgggaatgcttcacgccattcgtgaacggcagcttcttcgagcacgacgggcag
ccctactgtgaggtgcactaccacgagcggcgcggctcgctgtgttctggctgccagaag
cccatcaccggccgctgcatcaccgccatggccaagaagttccaccccgagcacttcgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system