KEGG   Homo sapiens (human): 586Help
Entry
586               CDS       T01001                                 

Gene name
BCAT1, BCATC, BCT1, ECA39, MECA39, PNAS121, PP18
Definition
(RefSeq) branched chain amino acid transaminase 1 (EC:2.6.1.42)
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    586 (BCAT1)
   01230 Biosynthesis of amino acids
    586 (BCAT1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    586 (BCAT1)
   00280 Valine, leucine and isoleucine degradation
    586 (BCAT1)
   00290 Valine, leucine and isoleucine biosynthesis
    586 (BCAT1)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    586 (BCAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     586 (BCAT1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class IV
   586 (BCAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p12.1
AA seq 386 aa AA seqDB search
MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTV
EWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRM
YRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQ
WGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPK
LASRILSKLTDIQYGREESDWTIVLS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattgcagtaacggatgctccgcagagtgtaccggagaaggaggatcaaaagag
gtggtggggacttttaaggctaaagacctaatagtcacaccagctaccattttaaaggaa
aaaccagaccccaataatctggtttttggaactgtgttcacggatcatatgctgacggtg
gagtggtcctcagagtttggatgggagaaacctcatatcaagcctcttcagaacctgtca
ttgcaccctggctcatcagctttgcactatgcagtggaattatttgaaggattgaaggca
tttcgaggagtagataataaaattcgactgtttcagccaaacctcaacatggatagaatg
tatcgctctgctgtgagggcaactctgccggtatttgacaaagaagagctcttagagtgt
attcaacagcttgtgaaattggatcaagaatgggtcccatattcaacatctgctagtctg
tatattcgtcctacattcattggaactgagccttctcttggagtcaagaagcctaccaaa
gccctgctctttgtactcttgagcccagtgggaccttatttttcaagtggaacctttaat
ccagtgtccctgtgggccaatcccaagtatgtaagagcctggaaaggtggaactggggac
tgcaagatgggagggaattacggctcatctctttttgcccaatgtgaagcagtagataat
gggtgtcagcaggtcctgtggctctatggagaggaccatcagatcactgaagtgggaact
atgaatctttttctttactggataaatgaagatggagaagaagaactggcaactcctcca
ctagatggcatcattcttccaggagtgacaaggcggtgcattctggacctggcacatcag
tggggtgaatttaaggtgtcagagagatacctcaccatggatgacttgacaacagccctg
gaggggaacagagtgagagagatgtttggctctggtacagcctgtgttgtttgcccagtt
tctgatatactgtacaaaggcgagacaatacacattccaactatggagaatggtcctaag
ctggcaagccgcatcttgagcaaattaactgatatccagtatggaagagaagagagcgac
tggacaattgtgctatcctga

DBGET integrated database retrieval system