KEGG   Homo sapiens (human): 5867Help
Entry
5867              CDS       T01001                                 

Gene name
RAB4A, HRES-1, HRES-1/RAB4, HRES1, RAB4
Definition
RAB4A, member RAS oncogene family
Orthology
K07879  
Ras-related protein Rab-4A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5867 (RAB4A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    5867 (RAB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42-q43
AA seq 113 aa AA seqDB search
MISPDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEE
AFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaccagatgcccgaatgctagcgagccagaacattgtgatcatcctttgtgga
aacaagaaggacctggatgcagatcgtgaagttaccttcttagaagcctccagatttgct
caagaaaatgagctgatgtttttggaaacaagtgcgctcacaggggagaatgtagaagag
gcttttgtacagtgtgcaagaaaaatacttaacaaaatcgaatcaggtgagctggaccca
gaaagaatgggctcaggtattcagtacggagatgctgccttgagacagctgaggtcaccg
cggcgcgcacaggccccgaacgctcaggagtgtggttgttag

DBGET integrated database retrieval system