KEGG   Homo sapiens (human): 587Help
Entry
587               CDS       T01001                                 

Gene name
BCAT2, BCAM, BCATM, BCT2, PP18
Definition
(RefSeq) branched chain amino acid transaminase 2 (EC:2.6.1.42)
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    587 (BCAT2)
   01230 Biosynthesis of amino acids
    587 (BCAT2)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    587 (BCAT2)
   00280 Valine, leucine and isoleucine degradation
    587 (BCAT2)
   00290 Valine, leucine and isoleucine biosynthesis
    587 (BCAT2)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    587 (BCAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     587 (BCAT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class IV
   587 (BCAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 392 aa AA seqDB search
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccgctctggggcagatctgggcacgaaagcttctctctgtcccttggctt
ctgtgtggtcccagaagatatgcctcctccagtttcaaggctgcagacctgcagctggaa
atgacacagaagcctcataagaagcctggccccggcgagcccctggtgtttgggaagaca
tttaccgaccacatgctgatggtggaatggaatgacaagggctggggccagccccgaatc
cagcccttccagaacctcacgctgcacccagcctcctccagcctccactactccctgcag
ctgtttgagggcatgaaggcgttcaaaggcaaagaccagcaggtgcgcctcttccgcccc
tggctcaacatggaccggatgctgcgctcagccatgcgcctgtgcctgccgagtttcgac
aagctggagttgctggagtgcatccgccggctcatcgaagtggacaaggactgggtcccc
gatgccgccggcaccagcctctatgtgcggcctgtgctcattgggaacgagccctcgctg
ggtgtcagccagcccacgcgcgcgctcctgttcgtcattctctgcccagtgggtgcctac
ttccctggaggctccgtgaccccggtctccctcctggccgacccagccttcatccgggcc
tgggtgggcggggtcggcaactacaagttaggtgggaattatgggcccaccgtgttagtg
caacaggaggcactcaagcggggctgtgaacaggtcctctggctgtatgggcccgaccac
cagctcaccgaggtgggaaccatgaacatctttgtctactggacccacgaagatggggtg
ctggagctggtgacgcccccgctgaatggtgttatcctgcctggagtggtcagacagagt
ctactggacatggctcagacctggggtgagttccgggtggtggagcgcacgatcaccatg
aagcagttgctgcgggccctggaggagggccgcgtgcgggaagtctttggctcgggcacc
gcttgccaggtctgcccagtgcaccgaatcctgtacaaagacaggaacctccacattccc
accatggaaaatgggcctgagctgatcctccgcttccagaaggagctgaaggagatccag
tacggaatcagagcccacgagtggatgttcccggtgtga

DBGET integrated database retrieval system