KEGG   Homo sapiens (human): 587Help
Entry
587               CDS       T01001                                 

Gene name
BCAT2, BCAM, BCATM, BCT2, PP18
Definition
branched chain amino-acid transaminase 2, mitochondrial (EC:2.6.1.42)
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hsa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:hsa00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:hsa00770]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 300 aa AA seqDB search
MAAAALGQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLI
EVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVSLL
ADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFV
YWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRV
REVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccgctctggggcagctgtttgagggcatgaaggcgttcaaaggcaaagac
cagcaggtgcgcctcttccgcccctggctcaacatggaccggatgctgcgctcagccatg
cgcctgtgcctgccgagtttcgacaagctggagttgctggagtgcatccgccggctcatc
gaagtggacaaggactgggtccccgatgccgccggcaccagcctctatgtgcggcctgtg
ctcattgggaacgagccctcgctgggtgtcagccagcccacgcgcgcgctcctgttcgtc
attctctgcccagtgggtgcctacttccctggaggctccgtgaccccggtctccctcctg
gccgacccagccttcatccgggcctgggtgggcggggtcggcaactacaagttaggtggg
aattatgggcccaccgtgttagtgcaacaggaggcactcaagcggggctgtgaacaggtc
ctctggctgtatgggcccgaccaccagctcaccgaggtgggaaccatgaacatctttgtc
tactggacccacgaagatggggtgctggagctggtgacgcccccgctgaatggtgttatc
ctgcctggagtggtcagacagagtctactggacatggctcagacctggggtgagttccgg
gtggtggagcgcacgatcaccatgaagcagttgctgcgggccctggaggagggccgcgtg
cgggaagtctttggctcgggcaccgcttgccaggtctgcccagtgcaccgaatcctgtac
aaagacaggaacctccacattcccaccatggaaaatgggcctgagctgatcctccgcttc
cagaaggagctgaaggagatccagtacggaatcagagcccacgagtggatgttcccggtg
tga

DBGET integrated database retrieval system