KEGG   Homo sapiens (human): 5874Help
Entry
5874              CDS       T01001                                 

Gene name
RAB27B, C25KG
Definition
RAB27B, member RAS oncogene family
Orthology
K07886  
Ras-related protein Rab-27B
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.2
AA seq 218 aa AA seqDB search
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatggagactatgattatctgatcaaactcctggccctcggggattcaggggtg
gggaagacaacatttctttatagatacacagataataaattcaatcccaaattcatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatgcacaaggaccgaatgga
tcttcagggaaagcatttaaagtgcatcttcagctttgggacactgcgggacaagagcgg
ttccggagtctcaccactgcatttttcagagacgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctaccagatcag
agggaagtcaatgaacggcaagctcgggaactggctgacaaatatggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagctgtagaaacccttttggactta
atcatgaagcgaatggaacagtgtgtggagaagacacaaatccctgatactgtcaatggt
ggaaattctggaaacttggatggggaaaagccaccagagaagaaatgtatctgctag

DBGET integrated database retrieval system