KEGG   Homo sapiens (human): 5874Help
Entry
5874              CDS       T01001                                 

Gene name
RAB27B, C25KG
Definition
RAB27B, member RAS oncogene family
Orthology
K07886  
Ras-related protein Rab-27B
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    5874 (RAB27B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5874 (RAB27B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5874 (RAB27B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.2
AA seq 218 aa AA seqDB search
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatggagactatgattatctgatcaaactcctggccctcggggattcaggggtg
gggaagacaacatttctttatagatacacagataataaattcaatcccaaattcatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatgcacaaggaccgaatgga
tcttcagggaaagcatttaaagtgcatcttcagctttgggacactgcgggacaagagcgg
ttccggagtctcaccactgcatttttcagagacgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctaccagatcag
agggaagtcaatgaacggcaagctcgggaactggctgacaaatatggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagctgtagaaacccttttggactta
atcatgaagcgaatggaacagtgtgtggagaagacacaaatccctgatactgtcaatggt
ggaaattctggaaacttggatggggaaaagccaccagagaagaaatgtatctgctag

DBGET integrated database retrieval system