KEGG   Homo sapiens (human): 5888Help
Entry
5888              CDS       T01001                                 

Gene name
RAD51, BRCC5, HRAD51, HsRad51, HsT16930, MRMV2, RAD51A, RECA
Definition
RAD51 recombinase
Orthology
K04482  
DNA repair protein RAD51
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Pathways in cancer
Pancreatic cancer
Disease
H01287  
Congenital mirror movements (CMM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    5888 (RAD51)
   03460 Fanconi anemia pathway
    5888 (RAD51)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5888 (RAD51)
   05212 Pancreatic cancer
    5888 (RAD51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 340 aa AA seqDB search
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILTESRSVARLECNSVILVYCTLRLSGSSDSPASASRVVGTTGGIET
GSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYG
LSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELS
ARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTR
LYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacccatttcacggttagagcagtgtggcataaatgccaacgatgtgaagaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcgccaaagaaggagcta
ataaatattaagggaattagtgaagccaaagctgataaaattctgacggagtctcgctct
gttgccaggctggagtgcaatagcgtgatcttggtctactgcaccctccgcctctcaggt
tcaagtgattctcctgcctcagcctcccgagtagttgggactacaggtggaattgagact
ggatctatcacagaaatgtttggagaattccgaactgggaagacccagatctgtcatacg
ctagctgtcacctgccagcttcccattgaccggggtggaggtgaaggaaaggccatgtac
attgacactgagggtacctttaggccagaacggctgctggcagtggctgagaggtatggt
ctctctggcagtgatgtcctggataatgtagcatatgctcgagcgttcaacacagaccac
cagacccagctcctttatcaagcatcagccatgatggtagaatctaggtatgcactgctt
attgtagacagtgccaccgccctttacagaacagactactcgggtcgaggtgagctttca
gccaggcagatgcacttggccaggtttctgcggatgcttctgcgactcgctgatgagttt
ggtgtagcagtggtaatcactaatcaggtggtagctcaagtggatggagcagcgatgttt
gctgctgatcccaaaaaacctattggaggaaatatcatcgcccatgcatcaacaaccaga
ttgtatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgt
cttcctgaagctgaagctatgttcgccattaatgcagatggagtgggagatgccaaagac
tga

DBGET integrated database retrieval system