KEGG   Homo sapiens (human): 59Help
Entry
59                CDS       T01001                                 

Gene name
ACTA2, AAT6, ACTSA, MYMY5
Definition
actin, alpha 2, smooth muscle, aorta
Orthology
K12313  
actin, aortic smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Disease
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
H01396  
Moyamoya Disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    59 (ACTA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   59 (ACTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23.3
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcactgccttggtgtgtgacaatggctctgggctctgtaag
gccggctttgctggggacgatgctcccagggctgttttcccatccattgtgggacgtccc
agacatcagggggtgatggtgggaatgggacaaaaagacagctacgtgggtgacgaagca
cagagcaaaagaggaatcctgaccctgaagtacccgatagaacatggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctacaatgagcttcgtgttgcccct
gaagagcatcccaccctgctcacggaggcacccctgaaccccaaggccaaccgggagaaa
atgactcaaattatgtttgagactttcaatgtcccagccatgtatgtggctatccaggcg
gtgctgtctctctatgcctctggacgcacaactggcatcgtgctggactctggagatggt
gtcacccacaatgtccccatctatgagggctatgccttgccccatgccatcatgcgtctg
gatctggctggccgagatctcactgactacctcatgaagatcctgactgagcgtggctat
tccttcgttactactgctgagcgtgagattgtccgggacatcaaggagaaactgtgttat
gtagctctggactttgaaaatgagatggccactgccgcatcctcatcctcccttgagaag
agttacgagttgcctgatgggcaagtgatcaccatcggaaatgaacgtttccgctgccca
gagaccctgttccagccatccttcatcgggatggagtctgctggcatccatgaaaccacc
tacaacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaatgtc
ctatcagggggcaccactatgtaccctggcattgccgaccgaatgcagaaggagatcacg
gccctagcacccagcaccatgaagatcaagatcattgcccctccggagcgcaaatactct
gtctggatcggtggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggaatacgatgaagccgggccttccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system