KEGG   Homo sapiens (human): 59Help
Entry
59                CDS       T01001                                 

Gene name
ACTA2, ACTSA
Definition
(RefSeq) actin, alpha 2, smooth muscle, aorta
  KO
K12313  actin, aortic smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04926  Relaxin signaling pathway
Disease
H00801  Familial thoracic aortic aneurysm and dissection (TAAD)
H01396  Moyamoya disease
H01630  Patent ductus arteriosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    59 (ACTA2)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    59 (ACTA2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    59 (ACTA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     59 (ACTA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   59 (ACTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 59
NCBI-ProteinID: NP_001135417
OMIM: 102620
HGNC: 130
Ensembl: ENSG00000107796
Vega: OTTHUMG00000018700
Pharos: P62736(Tbio)
UniProt: P62736 D2JYH4
Position
10q23.31
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcactgccttggtgtgtgacaatggctctgggctctgtaag
gccggctttgctggggacgatgctcccagggctgttttcccatccattgtgggacgtccc
agacatcagggggtgatggtgggaatgggacaaaaagacagctacgtgggtgacgaagca
cagagcaaaagaggaatcctgaccctgaagtacccgatagaacatggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctacaatgagcttcgtgttgcccct
gaagagcatcccaccctgctcacggaggcacccctgaaccccaaggccaaccgggagaaa
atgactcaaattatgtttgagactttcaatgtcccagccatgtatgtggctatccaggcg
gtgctgtctctctatgcctctggacgcacaactggcatcgtgctggactctggagatggt
gtcacccacaatgtccccatctatgagggctatgccttgccccatgccatcatgcgtctg
gatctggctggccgagatctcactgactacctcatgaagatcctgactgagcgtggctat
tccttcgttactactgctgagcgtgagattgtccgggacatcaaggagaaactgtgttat
gtagctctggactttgaaaatgagatggccactgccgcatcctcatcctcccttgagaag
agttacgagttgcctgatgggcaagtgatcaccatcggaaatgaacgtttccgctgccca
gagaccctgttccagccatccttcatcgggatggagtctgctggcatccatgaaaccacc
tacaacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaatgtc
ctatcagggggcaccactatgtaccctggcattgccgaccgaatgcagaaggagatcacg
gccctagcacccagcaccatgaagatcaagatcattgcccctccggagcgcaaatactct
gtctggatcggtggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggaatacgatgaagccgggccttccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system