KEGG   Homo sapiens (human): 5903Help
Entry
5903              CDS       T01001                                 

Gene name
RANBP2, ADANE, ANE1, IIAE3, NUP358, TRP1, TRP2
Definition
RAN binding protein 2 (EC:5.2.1.8)
Orthology
K12172  
E3 SUMO-protein ligase RanBP2
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    5903 (RANBP2)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    5903 (RANBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12.3
AA seq 3224 aa AA seqDB search
MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVEVYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYA
NLMLLTLSTRDVQESRELLQSFDSALQSVKSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHSSNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEIVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVREPELEDLT
RYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPHETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIH
RKAVPGNVAKLRLLVQHEINTLRAQEKHGLQPALLVHWAECLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAV
NGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIK
IIDDSDSNLSVVKKLPVPLESVKEMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTP
SPTRYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHR
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPATGILSPRGDD
YFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIEFGKTNFVQPMPGEGLRPSLP
TQAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDG
YSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKS
VFGTPTLETANKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAK
LFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGS
DRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKAPGTNVAMASNQAV
RIVKEPTSHDNKDICKSDAGNLNFEFQVAKKEGSWWHCNSCSLKNASTAKKCVSCQNLNP
SNKELVGPPLAETVFTPKTSPENVQDRFALVTPKKEGHWDCSICLVRNEPTVSRCIACQN
TKSANKSGSSFVHQASFKFGQGDLPKPINSDFRSVFSTKEGQWDCSACLVQNEGSSTKCA
ACQNPRKQSLPATSIPTPASFKFGTSETSKTLKSGFEDMFAKKEGQWDCSSCLVRNEANA
TRCVACQNPDKPSPSTSVPAPASFKFGTSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNE
ASATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEA
SATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEAS
ATKCIACQCPSKQNQTTAISTPASSEISKAPKSGFEGMFIRKGQWDCSVCCVQNESSSLK
CVACDASKPTHKPIAEAPSAFTLGSEMKLHDSSGSQVGTGFKSNFSEKASKFGNTEQGFK
FGHVDQENSPSFMFQGSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKSEKPLENGT
GFQAQDISGQKNGRGVIFGQTSSTFTFADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLFS
SQYGKMANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRV
KLFRFDAEVSQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSG
SDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDT
GRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGP
TLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKS
PAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLY
RYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTER
VWLWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPR
ESPCGKIAVAVLEETTRERTDVIQGDDVADATSEVEVSSTSETTPKAVVSPPKFVFGSES
VKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELS
KNSDIEQSSDSKVKNLFASFPTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTP
TAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLE
ENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKV
QEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKSISSPSVSSETMDKPVDLS
TRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVF
GTQSVGTQSAGKVGEDEDGSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKL
YRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSN
NALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAELSK
ETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPDF
VCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLKKAE
HLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI
NT seq 9675 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcagcaaggctgacgtggagcggtacatcgcctcggtgcagggctccaccccg
tcgcctcgacagaagtcaatgaaaggattctattttgcaaagctgtattatgaagctaaa
gaatatgatcttgctaaaaaatacatatgtacttacattaatgtgcaagagagggatccc
aaagctcacagatttctgggtcttctttatgaattggaagaaaacacagacaaagccgtt
gaatgttacaggcgttcagtggaattaaacccaacacaaaaagatcttgtgttgaagatt
gcagaattgctttgtaaaaatgatgttactgatggaagagcaaaatactggcttgaaaga
gcagccaaacttttcccaggaagtcctgcaatttataaactaaaggaacagcttctagat
tgtgaaggtgaagatggatggaataaactttttgacttgattcagtcagaactttatgta
agacctgatgacgtccatgtgaacatccggctagtggaggtgtatcgctcaactaaaaga
ttgaaggatgctgtggcccactgccatgaggcagagaggaacatagctttgcgttcaagt
ttagaatggaattcgtgtgttgtacagacccttaaggaatatctggagtctttacagtgt
ttggagtctgataaaagtgactggcgagcaaccaatacagacttactgctggcctatgct
aatcttatgcttcttacgctttccactagagatgtgcaggaaagtagagaattactgcaa
agttttgatagtgctcttcagtctgtgaaatctttgggtggaaatgatgaactgtcagct
actttcttagaaatgaaaggacatttctacatgcatgctggttctctgcttttgaagatg
ggtcagcatagtagtaatgttcaatggcgagctctttctgagctggctgcattgtgctat
ctcatagcatttcaggttccaagaccaaagattaaattaataaaaggtgaagctggacaa
aatctgctggaaatgatggcctgtgaccgactgagccaatcagggcacatgttgctaaac
ttaagtcgtggcaagcaagattttttaaaagagattgttgaaacttttgccaacaaaagc
gggcagtctgcattatatgatgctctgttttctagtcagtcacctaaggatacatctttt
cttggtagcgatgatattggaaacattgatgtacgagaaccagagcttgaagatttgact
agatacgatgttggtgctattcgagcacataatggtagtcttcagcaccttacttggctt
ggcttacagtggaattcattgcctgctttacctggaatccgaaaatggctaaaacagctt
ttccatcatttgccccatgaaacctcaaggcttgaaacaaatgcacctgaatcaatatgt
attttagatcttgaagtatttctccttggagtagtatataccagccacttacaattaaag
gagaaatgtaattctcaccacagctcctatcagccgttatgcctgccccttcctgtgtgt
aaacagctttgtacagaaagacaaaaatcttggtgggatgcggtttgtactctgattcac
agaaaagcagtacctggaaacgtagcaaaattgagacttctagttcagcatgaaataaac
actctaagagcccaggaaaaacatggccttcaacctgctctgcttgtacattgggcagaa
tgccttcagaaaacgggcagcggtcttaattctttttatgatcaacgagaatacataggg
agaagtgttcattattggaagaaagttttgccattgttgaagataataaaaaagaagaac
agtattcctgaacctattgatcctctgtttaaacattttcatagtgtagacattcaggca
tcagaaattgttgaatatgaagaagacgcacacataacttttgctatattggatgcagta
aatggaaatatagaagatgctgtgactgcttttgaatctataaaaagtgttgtttcttat
tggaatcttgcactgatttttcacaggaaggcagaagacattgaaaatgatgccctttct
cctgaagaacaagaagaatgcaaaaattatctgagaaagaccagggactacctaataaag
attatagatgacagtgattcaaatctttcagtggtcaagaaattgcctgtgcccctggag
tctgtaaaagagatgcttaattcagtcatgcaggaactcgaagactatagtgaaggaggt
cctctctataaaaatggttctttgcgaaatgcagattcagaaataaaacattctacaccg
tctcctaccagatattcactatcaccaagtaaaagttacaagtattctcccaaaacacca
cctcgatgggcagaagatcagaattctttactgaaaatgatttgccaacaagtagaggcc
attaagaaagaaatgcaggagttgaaactaaatagcagtaactcagcatcccctcatcgt
tggcccacagagaattatggaccagactcagtgcctgatggatatcaggggtcacagaca
tttcatggggctccactaacagttgcaactactggcccttcagtatattatagtcagtca
ccagcatataattcccagtatcttctcagaccagcagctaatgttactcccacaaagggc
ccagtctatggcatgaataggcttccaccccaacagcatatttatgcctatccgcaacag
atgcacacaccgccagtgcaaagctcatctgcttgtatgttctctcaggagatgtatggt
cctcctgcattgcgttttgagtctcctgcaacgggaattctatcgcccaggggtgatgat
tactttaattacaatgttcaacagacaagcacaaatccacctttgccagaaccaggatat
ttcacaaaacctccgattgcagctcatgcttcaagatctgcagaatctaagactatagaa
tttgggaaaactaattttgttcagcccatgccgggtgaaggattaaggccatctttgcca
acacaagcacacacaacacagccaactccttttaaatttaactcaaatttcaaatcaaat
gatggtgacttcacgttttcctcaccacaggttgtgacacagccccctcctgcagcttac
agtaacagtgaaagccttttaggtctcctgacttcagataaacccttgcaaggagatggc
tatagtggagccaaaccaattcctggtggtcaaaccattgggcctcgaaatacattcaat
tttggaagcaaaaatgtgtctggaatttcatttacagaaaacatggggtcgagtcagcaa
aagaattctggttttcggcgaagtgatgatatgtttactttccatggtccagggaaatca
gtatttggaacacccactttagagacagcaaacaagaatcatgagacagatggaggaagt
gcccatggggatgatgatgatgacggtcctcactttgagcctgtagtacctcttcctgat
aagattgaagtaaaaactggtgaggaagatgaagaagaattcttttgcaaccgcgcgaaa
ttgtttcgtttcgatgtagaatccaaagaatggaaagaacgtgggattggcaatgtaaaa
atactgaggcataaaacatctggtaaaattcgccttctaatgagacgagagcaagtattg
aaaatctgtgcaaatcattacatcagtccagatatgaaattgacaccaaatgctggatca
gacagatcttttgtatggcatgcccttgattatgcagatgagttgccaaaaccagaacaa
cttgctattaggttcaaaactcctgaggaagcagcactttttaaatgcaagtttgaagaa
gcccagagcattttaaaagccccaggaacaaatgtagccatggcgtcaaatcaggctgtc
agaattgtaaaagaacccacaagtcatgataacaaggatatttgcaaatctgatgctgga
aacctgaattttgaatttcaggttgcaaagaaagaagggtcttggtggcattgtaacagc
tgctcattaaagaatgcttcaactgctaagaaatgtgtatcatgccaaaatctaaaccca
agcaataaagagctcgttggcccaccattagctgaaactgtttttactcctaaaaccagc
ccagagaatgttcaagatcgatttgcattggtgactccaaagaaagaaggtcactgggat
tgtagtatttgtttagtaagaaatgaacctactgtatctaggtgcattgcgtgtcagaat
acaaaatctgctaacaaaagtggatcttcatttgttcatcaagcttcatttaaatttggc
cagggagatcttcctaaacctattaacagtgatttcagatctgttttttctacaaaggaa
ggacagtgggattgcagtgcatgtttggtacaaaatgaggggagctctacaaaatgtgct
gcttgtcagaatccgagaaaacagagtctacctgctacttctattccaacacctgcctct
tttaagtttggtacttcagagacaagtaaaactctaaaaagtggatttgaagacatgttt
gctaagaaggaaggacagtgggattgcagttcatgcttagtgcgaaatgaagcaaatgct
acaagatgtgttgcttgtcagaatccggataaaccaagtccatctacttctgttccagct
cctgcctcttttaagtttggtacttcagagacaagcaaggctccaaagagcggatttgag
ggaatgttcactaagaaggagggacagtgggattgcagtgtgtgcttagtaagaaatgaa
gccagtgctaccaaatgtattgcttgtcagaatccaggtaaacaaaatcaaactacttct
gcagtttcaacacctgcctcttcagagacaagcaaggctccaaagagcggatttgaggga
atgttcactaagaaggagggacagtgggattgcagtgtgtgcttagtaagaaatgaagcc
agtgctaccaaatgtattgcttgtcagaatccaggtaaacaaaatcaaactacttctgca
gtttcaacacctgcctcttcagagacaagcaaggctccaaagagcggatttgagggaatg
ttcactaagaaggaaggacagtgggattgcagtgtgtgcttagtaagaaatgaagccagt
gctaccaaatgtattgcttgtcagtgtccaagtaaacaaaatcaaacaactgcaatttca
acacctgcctcttcggagataagcaaggctccaaagagtggatttgaaggaatgttcatc
aggaaaggacagtgggattgtagtgtttgctgtgtacaaaatgagagttcttccttaaaa
tgtgtggcttgtgatgcctctaaaccaactcataaacctattgcagaagctccttcagct
ttcacactgggctcagaaatgaagttgcatgactcttctggaagtcaggtgggaacagga
tttaaaagtaatttctcagaaaaagcttctaagtttggcaatacagagcaaggattcaaa
tttgggcatgtggatcaagaaaattcaccttcatttatgtttcagggttcttctaataca
gaatttaagtcaaccaaagaaggattttccatccctgtgtctgctgatggatttaaattt
ggcatttcggaaccaggaaatcaagaaaagaaaagtgaaaagcctcttgaaaatggtact
ggcttccaggctcaggatattagtggccagaagaatggccgtggtgtgatttttggccaa
acaagtagcacttttacatttgcagatcttgcaaaatcaacttcaggagaaggatttcag
tttggcaaaaaagaccccaatttcaagggattttcaggtgctggagaaaaattattctca
tcacaatacggtaaaatggccaataaagcaaacacttccggtgactttgagaaagatgat
gatgcctataagactgaggacagcgatgacatccattttgaaccagtagttcaaatgccc
gaaaaagtagaacttgtaacaggagaagaagatgaaaaagttctgtattcacagcgggta
aaactatttagatttgatgctgaggtaagtcagtggaaagaaaggggcttggggaactta
aaaattctcaaaaacgaggtcaatggcaaactaagaatgctgatgcgaagagaacaagta
ctaaaagtgtgtgctaatcattggataacgactacgatgaacctgaagcctctctctgga
tcagatagagcatggatgtggttagccagtgatttctctgatggtgatgccaaactagag
cagttggcagcaaaatttaaaacaccagagctggctgaagaattcaagcagaaatttgag
gaatgccagcggcttctgttagacataccacttcaaactccccataaacttgtagatact
ggcagagctgccaagttaatacagagagctgaagaaatgaagagtggactgaaagatttc
aaaacatttttgacaaatgatcaaacaaaagtcactgaggaagaaaataagggttcaggt
acaggtgcggccggtgcctcagacacaacaataaaacccaatcctgaaaacactgggccc
acattagaatgggataactatgatttaagggaagatgctttggatgatagtgtcagtagt
agctcagtacatgcttctccattggcaagtagccctgtgagaaaaaatcttttccgtttt
ggtgagtcaacaacaggatttaacttcagttttaaatctgctttgagtccatctaagtct
cctgccaagttgaatcagagtgggacttcagttggcactgatgaagaatctgatgttact
caagaagaagagagagatggacagtactttgaacctgttgttcctttacctgatctagtt
gaagtatccagtggtgaggaaaatgaacaagttgtttttagtcacagggcaaaactctac
agatatgataaagatgttggtcaatggaaagaaaggggcattggtgatataaagatttta
cagaattatgataataagcaagttcgtatagtgatgagaagggaccaagtattaaaactt
tgtgccaatcacagaataactccagacatgactttgcaaaatatgaaagggacagaaaga
gtatggttgtggactgcatgtgattttgcagatggagaaagaaaagtagagcatttagct
gttcgttttaaactacaggatgttgcagactcgtttaagaaaatttttgatgaagcaaaa
acagcccaggaaaaagattctttgataacacctcatgtttctcggtcaagcactcccaga
gagtcaccatgtggcaaaattgctgtagctgtattagaagaaaccacaagagagaggaca
gatgttattcagggtgatgatgtagcagatgcaacttcagaagttgaagtgtctagcaca
tctgaaacaacaccaaaagcagtggtttctcctccaaagtttgtatttggttcagagtct
gttaaaagcatttttagtagtgaaaaatcaaaaccatttgcattcggcaacagttcagcc
actgggtctttgtttggatttagttttaatgcacctttgaaaagtaacaatagtgaaact
agttcagtagcccagagtggatctgaaagcaaagtggaacctaaaaaatgtgaactgtca
aagaactctgatatcgaacagtcttcagatagcaaagtcaaaaatctctttgcttccttt
ccaacggaagaatcttcaatcaactacacatttaaaacaccagaaaaggcaaaagagaag
aaaaaacctgaagattctccctcagatgatgatgttctcattgtatatgaactaactcca
accgctgagcagaaagcccttgcaaccaaacttaaacttcctccaactttcttctgctac
aagaatagaccagattatgttagtgaagaagaggaggatgatgaagatttcgaaacagct
gtcaagaaacttaatggaaaactatatttggatggctcagaaaaatgtagacccttggaa
gaaaatacagcagataatgagaaagaatgtattattgtttgggaaaagaaaccaacagtt
gaagagaaggcaaaagcagatacgttaaaacttccacctacatttttttgtggagtctgt
agtgatactgatgaagacaatggaaatggggaagactttcaatcagagcttcaaaaagtt
caggaagctcaaaaatctcagacagaagaaataactagcacaactgacagtgtatataca
ggtgggactgaagtgatggtaccttctttctgtaaatctgaagaacctgattctattacc
aaatccattagttcaccatctgtttcctctgaaactatggacaaacctgtagatttgtca
actagaaaggaaattgatacagattctacaagccaaggggaaagcaagatagtttcattt
ggatttggaagtagcacagggctctcatttgcagacttggcttccagtaattctggagat
tttgcttttggttctaaagataaaaatttccaatgggcaaatactggagcagctgtgttt
ggaacacagtcagtcggaacccagtcagccggtaaagttggtgaagatgaagatggtagt
gatgaagaagtagttcataatgaagatatccattttgaaccaatagtgtcactaccagag
gtagaagtaaaatctggagaagaagatgaagaaattttgtttaaagagagagccaaactt
tatagatgggatcgggatgtcagtcagtggaaggagcgcggtgttggagatataaagatt
ctttggcatacaatgaagaattattaccggatcctaatgagaagagaccaggtttttaaa
gtgtgtgcaaaccacgttattactaaaacaatggaattaaagcccttaaatgtttcaaat
aatgctttagtttggactgcctcagattatgctgatggagaagcaaaagtagaacagctt
gcagtgagatttaaaactaaagaagtagctgattgtttcaagaaaacatttgaagaatgt
cagcagaatttaatgaaactccagaaaggacatgtatcactggcagcagaattatcaaag
gagaccaatcctgtggtgttttttgatgtttgtgcggacggtgaacctctagggcggata
actatggaattattttcaaacattgttcctcggactgctgagaacttcagagcactatgc
actggagagaaaggctttggtttcaagaattccatttttcacagagtaattccagatttt
gtttgccaaggaggagatatcaccaaacatgatggaacaggcggacagtccatttatgga
gacaaatttgaagatgaaaattttgatgtgaaacatactggtcctggtttactatccatg
gccaatcaaggccagaataccaataattctcaatttgttataacactgaagaaagcagaa
catttggactttaagcatgtagtatttgggtttgttaaggatggcatggatactgtgaaa
aagattgaatcatttggttctcccaaagggtctgtttgtcgaagaataactatcacagaa
tgtggacagatataa

DBGET integrated database retrieval system