KEGG   Homo sapiens (human): 5908Help
Entry
5908              CDS       T01001                                 

Gene name
RAP1B, K-REV, RAL1B
Definition
RAP1B, member of RAS oncogene family
Orthology
K07836  
Ras-related protein Rap-1B
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Long-term potentiation
Neurotrophin signaling pathway
Pancreatic secretion
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14
AA seq 184 aa AA seqDB search
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
CQLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaagtctgctttgact
gtacaatttgttcaaggaatttttgtagaaaaatacgatcctacgatagaagattcttat
agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga
acggagcaatttacagcaatgagggatttatacatgaaaaatggacaaggatttgcatta
gtttattccatcacagcacagtccacatttaacgatttacaagacctgagagaacagatt
cttcgagttaaagacactgatgatgttccaatgattcttgttggtaataagtgtgacttg
gaagatgaaagagttgtagggaaggaacaaggtcaaaatctagcaagacaatggaacaac
tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac
ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcatca
tgtcagctgctttaa

DBGET integrated database retrieval system