KEGG   Homo sapiens (human): 5923Help
Entry
5923              CDS       T01001                                 

Gene name
RASGRF1, CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, ras-GRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5923 (RASGRF1)
   04010 MAPK signaling pathway
    5923 (RASGRF1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    5923 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.2
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTET
SPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacagagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcacatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttacat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acagtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagtccgacgcctccttatattgtgatgatgttgac
attcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctacgccagtgtg
gagcggctgctggagaggctgacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgcgtcttcaccaccgccatcgtggtcctggacaagctcattacc
atctacaagaagcctatcagtgccattcctgccaggtcgctggagctcctgtttgccagt
ggccagaacaataagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaag
ttctcctcgccgccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaag
ctctccctgaacatccccatcatcactggcggcaaggccctggacctggccgccctcagc
tgcaactccaatggctacaccagcatgtactcggccatgtcacccttcagcaaggccacg
ctggacaccagcaagctctatgtgtccagcagcttcaccaacaagattccagatgagggc
gatacgacccctgagaagcccgaagacccttcagcgctcagcaagcagagctcagaagtc
tccatgagagaggagtcagatattgatcaaaaccagagtgatgatggtgatactgaaaca
tcaccaactaaatctccaacaacacccaaatcagtcaaaaacaaaaattcttcagagttc
ccactcttttcctataacaatggagtcgtcatgacctcctgtcgtgaactggacaataac
cgcagtgccttgtcggccgcctctgcctttgccatagcaaccgccggggccaacgagggc
accccaaacaaggagaagtaccggaggatgtccttagccagtgcagggtttcccccagac
cagaggaatggagacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaac
gtgctccgccactgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaa
tgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagctcctgacccaggag
cggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggtgacaaccag
atcacgctggaggagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaac
cactcagccctggagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaag
attccttatgaggagttcttcggacaaggatggatgaaactggaaaagaatgaaaggacc
ccttatatcatgaaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaa
atcatccgcaatgaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgta
gctgacatatgccgctgcctccacaactacaatgccgtactggagatcacctcgtccatg
aaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaa
gctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaagaatctcaga
gaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctcaccgac
ctggccttcatcgaggaggggacgcccaattacacggaagacggcctggtcaacttctcc
aagatgaggatgatatcccatattatccgagagattcgccagtttcaacaaactgcctac
aaaatagagcaccaagcaaaggtaacgcaatatttactggaccaatcttttgtaatggat
gaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system