KEGG   Homo sapiens (human): 5923Help
Entry
5923              CDS       T01001                                 

Gene name
RASGRF1, CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, ras-GRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.2
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTET
SPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacagagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcacatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttacat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acagtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagtccgacgcctccttatattgtgatgatgttgac
attcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctacgccagtgtg
gagcggctgctggagaggctgacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgcgtcttcaccaccgccatcgtggtcctggacaagctcattacc
atctacaagaagcctatcagtgccattcctgccaggtcgctggagctcctgtttgccagt
ggccagaacaataagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaag
ttctcctcgccgccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaag
ctctccctgaacatccccatcatcactggcggcaaggccctggacctggccgccctcagc
tgcaactccaatggctacaccagcatgtactcggccatgtcacccttcagcaaggccacg
ctggacaccagcaagctctatgtgtccagcagcttcaccaacaagattccagatgagggc
gatacgacccctgagaagcccgaagacccttcagcgctcagcaagcagagctcagaagtc
tccatgagagaggagtcagatattgatcaaaaccagagtgatgatggtgatactgaaaca
tcaccaactaaatctccaacaacacccaaatcagtcaaaaacaaaaattcttcagagttc
ccactcttttcctataacaatggagtcgtcatgacctcctgtcgtgaactggacaataac
cgcagtgccttgtcggccgcctctgcctttgccatagcaaccgccggggccaacgagggc
accccaaacaaggagaagtaccggaggatgtccttagccagtgcagggtttcccccagac
cagaggaatggagacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaac
gtgctccgccactgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaa
tgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagctcctgacccaggag
cggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggtgacaaccag
atcacgctggaggagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaac
cactcagccctggagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaag
attccttatgaggagttcttcggacaaggatggatgaaactggaaaagaatgaaaggacc
ccttatatcatgaaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaa
atcatccgcaatgaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgta
gctgacatatgccgctgcctccacaactacaatgccgtactggagatcacctcgtccatg
aaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaa
gctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaagaatctcaga
gaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctcaccgac
ctggccttcatcgaggaggggacgcccaattacacggaagacggcctggtcaacttctcc
aagatgaggatgatatcccatattatccgagagattcgccagtttcaacaaactgcctac
aaaatagagcaccaagcaaaggtaacgcaatatttactggaccaatcttttgtaatggat
gaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system