KEGG   Homo sapiens (human): 5925Help
Entry
5925              CDS       T01001                                 

Gene name
RB1, OSRC, RB, p105-Rb, pRb, pp110
Definition
retinoblastoma 1
Orthology
K06618  
retinoblastoma-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Disease
H00004  
Chronic myeloid leukemia (CML)
H00013  
Small cell lung cancer
H00017  
Esophageal cancer
H00022  
Bladder cancer
H00031  
Breast cancer
H00036  
Osteosarcoma
H00042  
Glioma
H00048  
Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5925 (RB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5925 (RB1)
   05203 Viral carcinogenesis
    5925 (RB1)
   05212 Pancreatic cancer
    5925 (RB1)
   05214 Glioma
    5925 (RB1)
   05220 Chronic myeloid leukemia
    5925 (RB1)
   05218 Melanoma
    5925 (RB1)
   05219 Bladder cancer
    5925 (RB1)
   05215 Prostate cancer
    5925 (RB1)
   05222 Small cell lung cancer
    5925 (RB1)
   05223 Non-small cell lung cancer
    5925 (RB1)
  Infectious diseases
   05166 HTLV-I infection
    5925 (RB1)
   05161 Hepatitis B
    5925 (RB1)
   05169 Epstein-Barr virus infection
    5925 (RB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5925 (RB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5925 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.2
AA seq 928 aa AA seqDB search
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgaaaaacggccgccaccgccgccgctgccgccgcggaaccc
ccggcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag
gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcatta
tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa
gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgggga
atctgtatctttattgcagcagttgacctagatgagatgtcgttcacttttactgagcta
cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaagaaattgatacc
agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca
ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg
atatctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttatta
gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta
tgtgtccttgactattttattaaactctcacctcccatgttgctcaaagaaccatataaa
acagctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagt
gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa
catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg
aattctcttggacttgtaacatctaatggacttccagaggttgaaaatctttctaaacga
tacgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat
aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt
aaccttgatgaagaggtgaatgtaattcctccacacactccagttaggactgttatgaac
actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg
atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag
gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggttgtgtcgaa
attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg
cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac
atttttcatatgtctttattggcgtgcgctcttgaggttgtaatggccacatatagcaga
agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg
cttaatttaaaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaaggc
aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc
cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa
ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac
actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactacg
cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag
ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc
cggctaaatacactttgtgaacgccttctgtctgagcacccagaattagaacatatcatc
tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg
gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa
ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa
cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc
atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca
ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct
ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca
acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattcggg
acttctgagaagttccagaaaataaatcagatggtatgtaacagcgaccgtgtgctcaaa
agaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaa
ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa
ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg
gatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system