KEGG   Homo sapiens (human): 5934Help
Entry
5934              CDS       T01001                                 

Gene name
RBL2, P130, Rb2
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  
retinoblastoma-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Cellular senescence
Human papillomavirus infection
Viral carcinogenesis
Network
N00194  
HPV E7 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5934 (RBL2)
   04151 PI3K-Akt signaling pathway
    5934 (RBL2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5934 (RBL2)
   04218 Cellular senescence
    5934 (RBL2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5934 (RBL2)
  Infectious diseases
   05165 Human papillomavirus infection
    5934 (RBL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5934 (RBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q08999(Tbio)
UniProt: 
Position
16q12.2
AA seq 1139 aa AA seqDB search
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggaggtgaccagtcgccaccgcccccgcctccccctccggcggcggcagcc
tcggatgaggaggaggaggacgacggcgaggcggaagacgccgcgccgcctgccgagtcg
cccacccctcagatccagcagcggttcgacgagctgtgcagccgcctcaacatggacgag
gcggcgcgggccgaggcctgggacagctaccgcagcatgagcgaaagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgttcca
actgtaagcaaagggacagtggaaggaaactatgtatctttaactagaatcctgaaatgt
tcagagcagagcttaatcgaattttttaataagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttctgct
gtaatttttaagaaatatgaacccatttttcaggacatctttaaataccctcaagaggag
caacctcgtcagcagcgaggaaggaaacagcggcgacagccctgtactgtgtctgaaatt
ttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttatcacctgctgctgtgtgctttggacttagtttatggaaatgca
cttcagtgttctaatcgtaaagaacttgtgaaccctaattttaaaggcttatctgaagat
tttcatgctaaagattctaaaccttcctctgaccccccttgtatcattgagaaactgtgt
tccttacatgatggcctagttttggaagcaaaggggataaaggaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatctcactggg
tttctagaacctgggaactttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgttgggaatttagatgagcggatatttcttggagaggatgctgaggag
gaaattgggactctctcaaggtgtctgaacgctggttcaggaacagagactgctgaaagg
gtgcagatgaaaaacatcttacagcagcattttgacaagtccaaagcacttagaatctcc
acaccactaactggtgttaggtacattaaggagaatagcccttgtgtgactccagtttct
acagctacgcatagcttgagtcgtcttcacaccatgctgacaggcctcaggaatgcacca
agtgagaaactggaacagattctcaggacatgttccagagatccaacccaggctattgct
aacagactgaaagaaatgtttgaaatatattctcagcatttccagccagacgaggatttc
agtaattgtgctaaagaaattgccagcaaacattttcgttttgcggagatgctttactat
aaagtattagaatctgttattgagcaggaacaaaaaagactaggagacatggatttatct
ggtattctggaacaagatgcgttccacagatctctcttggcctgctgccttgaggtcgtc
actttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgcct
ctttatcatttttataaggtgatagaagtattcattagagcagaagatggcctttgtaga
gaggtggtaaaacaccttaatcagattgaagaacagatcttagatcatttggcatggaaa
ccagagtctccactctgggaaaaaattagagacaatgaaaacagagttcctacatgtgaa
gaggtcatgccacctcagaacctggaaagggcagatgaaatttgcattgctggctcccct
ttgactcccagaagggtgactgaagttcgtgctgatactggaggacttggaaggagcata
acatctccaaccacattatacgataggtacagctccccaccagccagcactaccagaagg
cggctatttgttgagaatgatagcccctctgatggagggacgcctgggcgcatgccccca
cagcccctagtcaatgctgtccctgtgcagaatgtatctggggagactgtttctgtcaca
ccagttcctggacagactttggtcaccatggcaaccgccactgtcacagccaacaatggg
caaacggtaaccattcctgtgcaaggtattgccaatgaaaatggagggataacattcttc
cctgtccaagtcaatgttggggggcaggcacaagctgtgacaggctccatccagcccctc
agtgctcaggccctggctggaagtctgagctctcaacaggtgacaggaacaactttgcaa
gtccctggtcaagtggccattcaacagatttccccaggtggccaacagcagaagcaaggc
cagtctgtaaccagcagtagtaatagacccaggaagaccagctctttatcgcttttcttt
agaaaggtataccatttagcagctgtccgccttcgggatctctgtgccaaactagatatt
tcagatgaattgaggaaaaaaatctggacctgctttgaattctccataattcagtgtcct
gaacttatgatggacagacatctggaccagttattaatgtgtgccatttatgtgatggca
aaggtcacaaaagaagataagtccttccagaacattatgcgttgttataggactcagccg
caggcccggagccaggtgtatagaagtgttttgataaaagggaaaagaaaaagaagaaat
tctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagataga
accagtagagactccagtccagttatgaggtcaagcagcaccttgccagttccacagccc
agcagtgctcctcccacacctactcgcctcacaggtgccaacagtgacatggaagaagag
gagaggggagacctcattcagttctacaacaacatctacatcaaacagattaagacattt
gccatgaagtactcacaggcaaatatggatgctcctccactctctccctatccatttgta
agaacaggctcccctcgccgaatacagttgtctcaaaatcatcctgtctacatttcccca
cataaaaatgaaacaatgctttctcctcgagaaaagattttctattacttcagcaacagt
ccttcaaagagactgagagaaattaatagtatgatacgcacaggagaaactcctactaaa
aagagaggaattcttttggaagatggaagtgaatcacctgcaaaaagaatttgcccagaa
aatcattctgccttattacgccgtctccaagatgtagctaatgaccgtggttcccactga

DBGET integrated database retrieval system