KEGG   Homo sapiens (human): 5934Help
Entry
5934              CDS       T01001                                 

Gene name
RBL2, P130, Rb2
Definition
retinoblastoma-like 2
Orthology
K16332  
retinoblastoma-like protein 2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5934 (RBL2)
   04151 PI3K-Akt signaling pathway
    5934 (RBL2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5934 (RBL2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5934 (RBL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    5934 (RBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.2
AA seq 1139 aa AA seqDB search
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgggaggtgaccagtcgccaccgcccccgcctccccctccggcggcggcagcc
tcggatgaggaggaggaggacgacggcgaggcggaagacgccgcgccgcctgccgagtcg
cccacccctcagatccagcagcggttcgacgagctgtgcagccgcctcaacatggacgag
gcggcgcgggccgaggcctgggacagctaccgcagcatgagcgaaagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgttcca
actgtaagcaaagggacagtggaaggaaactatgtatctttaactagaatcctgaaatgt
tcagagcagagcttaatcgaattttttaataagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttctgct
gtaatttttaagaaatatgaacccatttttcaggacatctttaaataccctcaagaggag
caacctcgtcagcagcgaggaaggaaacagcggcgacagccctgtactgtgtctgaaatt
ttccatttttgttgggtgctttttatatatgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttatcacctgctgctgtgtgctttggacttagtttatggaaatgca
cttcagtgttctaatcgtaaagaacttgtgaaccctaattttaaaggcttatctgaagat
tttcatgctaaagattctaaaccttcctctgaccccccttgtatcattgagaaactgtgt
tccttacatgatggcctagttttggaagcaaaggggataaaggaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatctcactggg
tttctagaacctgggaactttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgttgggaatttagatgagcggatatttcttggagaggatgctgaggag
gaaattgggactctctcaaggtgtctgaacgctggttcaggaacagagactgctgaaagg
gtgcagatgaaaaacatcttacagcagcattttgacaagtccaaagcacttagaatctcc
acaccactaactggtgttaggtacattaaggagaatagcccttgtgtgactccagtttct
acagctacgcatagcttgagtcgtcttcacaccatgctgacaggcctcaggaatgcacca
agtgagaaactggaacagattctcaggacatgttccagagatccaacccaggctattgct
aacagactgaaagaaatgtttgaaatatattctcagcatttccagccagacgaggatttc
agtaattgtgctaaagaaattgccagcaaacattttcgttttgcggagatgctttactat
aaagtattagaatctgttattgagcaggaacaaaaaagactaggagacatggatttatct
ggtattctggaacaagatgcgttccacagatctctcttggcctgctgccttgaggtcgtc
actttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgcct
ctttatcatttttataaggtgatagaagtattcattagagcagaagatggcctttgtaga
gaggtggtaaaacaccttaatcagattgaagaacagatcttagatcatttggcatggaaa
ccagagtctccactctgggaaaaaattagagacaatgaaaacagagttcctacatgtgaa
gaggtcatgccacctcagaacctggaaagggcagatgaaatttgcattgctggctcccct
ttgactcccagaagggtgactgaagttcgtgctgatactggaggacttggaaggagcata
acatctccaaccacattatacgataggtacagctccccaccagccagcactaccagaagg
cggctatttgttgagaatgatagcccctctgatggagggacgcctgggcgcatgccccca
cagcccctagtcaatgctgtccctgtgcagaatgtatctggggagactgtttctgtcaca
ccagttcctggacagactttggtcaccatggcaaccgccactgtcacagccaacaatggg
caaacggtaaccattcctgtgcaaggtattgccaatgaaaatggagggataacattcttc
cctgtccaagtcaatgttggggggcaggcacaagctgtgacaggctccatccagcccctc
agtgctcaggccctggctggaagtctgagctctcaacaggtgacaggaacaactttgcaa
gtccctggtcaagtggccattcaacagatttccccaggtggccaacagcagaagcaaggc
cagtctgtaaccagcagtagtaatagacccaggaagaccagctctttatcgcttttcttt
agaaaggtataccatttagcagctgtccgccttcgggatctctgtgccaaactagatatt
tcagatgaattgaggaaaaaaatctggacctgctttgaattctccataattcagtgtcct
gaacttatgatggacagacatctggaccagttattaatgtgtgccatttatgtgatggca
aaggtcacaaaagaagataagtccttccagaacattatgcgttgttataggactcagccg
caggcccggagccaggtgtatagaagtgttttgataaaagggaaaagaaaaagaagaaat
tctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagataga
accagtagagactccagtccagttatgaggtcaagcagcaccttgccagttccacagccc
agcagtgctcctcccacacctactcgcctcacaggtgccaacagtgacatggaagaagag
gagaggggagacctcattcagttctacaacaacatctacatcaaacagattaagacattt
gccatgaagtactcacaggcaaatatggatgctcctccactctctccctatccatttgta
agaacaggctcccctcgccgaatacagttgtctcaaaatcatcctgtctacatttcccca
cataaaaatgaaacaatgctttctcctcgagaaaagattttctattacttcagcaacagt
ccttcaaagagactgagagaaattaatagtatgatacgcacaggagaaactcctactaaa
aagagaggaattcttttggaagatggaagtgaatcacctgcaaaaagaatttgcccagaa
aatcattctgccttattacgccgtctccaagatgtagctaatgaccgtggttcccactga

DBGET integrated database retrieval system