KEGG   Homo sapiens (human): 59341Help
Entry
59341             CDS       T01001                                 

Gene name
TRPV4, BCYM3, CMT2C, HMSN2C, OTRPC4, SMAL, SPSMA, SSQTL1, TRP12, VRL2, VROAC
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  
transient receptor potential cation channel subfamily V member 4
Organism
hsa  Homo sapiens (human)
Pathway
Cellular senescence
Inflammatory mediator regulation of TRP channels
Fluid shear stress and atherosclerosis
Disease
H00455  
Spinal muscular atrophy (SMA)
H00522  
TRPV4-related skeletal dysplasias
H00524  
TRPV4-related peripheral neuropathies
H00856  
Distal hereditary motor neuropathies (dHMN)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    59341 (TRPV4)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    59341 (TRPV4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    59341 (TRPV4)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   59341 (TRPV4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9HBA0(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.11
AA seq 871 aa AA seqDB search
MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGEDGSLSPSPADASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHSSDN
KRWRKKIIEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDS
NLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGV
NSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKVCNEDQTNCTVPTYPSC
RDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDE
VVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcggattccagcgaaggcccccgcgcggggcccggggaggtggctgagctccccggg
gatgagagtggcaccccaggtggggaggcttttcctctctcctccctggccaatctgttt
gagggggaggatggctccctttcgccctcaccggctgatgccagtcgccctgctggccca
ggcgatgggcgaccaaatctgcgcatgaagttccagggcgccttccgcaagggggtgccc
aaccccatcgatctgctggagtccaccctatatgagtcctcggtggtgcctgggcccaag
aaagcacccatggactcactgtttgactacggcacctatcgtcaccactccagtgacaac
aagaggtggaggaagaagatcatagagaagcagccgcagagccccaaagcccctgcccct
cagccgccccccatcctcaaagtcttcaaccggcctatcctctttgacatcgtgtcccgg
ggctccactgctgacctggacgggctgctcccattcttgctgacccacaagaaacgccta
actgatgaggagtttcgagagccatctacggggaagacctgcctgcccaaggccttgctg
aacctgagcaatggccgcaacgacaccatccctgtgctgctggacatcgcggagcgcacc
ggcaacatgagggagttcattaactcgcccttccgtgacatctactatcgaggtcagaca
gccctgcacatcgccattgagcgtcgctgcaaacactacgtggaacttctcgtggcccag
ggagctgatgtccacgcccaggcccgtgggcgcttcttccagcccaaggatgaggggggc
tacttctactttggggagctgcccctgtcgctggctgcctgcaccaaccagccccacatt
gtcaactacctgacggagaacccccacaagaaggcggacatgcggcgccaggactcgcga
ggcaacacagtgctgcatgcgctggtggccattgctgacaacacccgtgagaacaccaag
tttgttaccaagatgtacgacctgctgctgctcaagtgtgcccgcctcttccccgacagc
aacctggaggccgtgctcaacaacgacggcctctcgcccctcatgatggctgccaagacg
ggcaagattgggatctttcagcacatcatccggcgggaggtgacggatgaggacacacgg
cacctgtcccgcaagttcaaggactgggcctatgggccagtgtattcctcgctttatgac
ctctcctccctggacacgtgtggggaagaggcctccgtgctggagatcctggtgtacaac
agcaagattgagaaccgccacgagatgctggctgtggagcccatcaatgaactgctgcgg
gacaagtggcgcaagttcggggccgtctccttctacatcaacgtggtctcctacctgtgt
gccatggtcatcttcactctcaccgcctactaccagccgctggagggcacaccgccgtac
ccttaccgcaccacggtggactacctgcggctggctggcgaggtcattacgctcttcact
ggggtcctgttcttcttcaccaacatcaaagacttgttcatgaagaaatgccctggagtg
aattctctcttcattgatggctccttccagctgctctacttcatctactctgtcctggtg
atcgtctcagcagccctctacctggcagggatcgaggcctacctggccgtgatggtcttt
gccctggtcctgggctggatgaatgccctttacttcacccgtgggctgaagctgacgggg
acctatagcatcatgatccagaagattctcttcaaggaccttttccgattcctgctcgtc
tacttgctcttcatgatcggctacgcttcagccctggtctccctcctgaacccgtgtgcc
aacatgaaggtgtgcaatgaggaccagaccaactgcacagtgcccacttacccctcgtgc
cgtgacagcgagaccttcagcaccttcctcctggacctgtttaagctgaccatcggcatg
ggcgacctggagatgctgagcagcaccaagtaccccgtggtcttcatcatcctgctggtg
acctacatcatcctcacctttgtgctgctcctcaacatgctcattgccctcatgggcgag
acagtgggccaggtctccaaggagagcaagcacatctggaagctgcagtgggccaccacc
atcctggacattgagcgctccttccccgtattcctgaggaaggccttccgctctggggag
atggtcaccgtgggcaagagctcggacggcactcctgaccgcaggtggtgcttcagggtg
gatgaggtgaactggtctcactggaaccagaacttgggcatcatcaacgaggacccgggc
aagaatgagacctaccagtattatggcttctcgcataccgtgggccgcctccgcagggat
cgctggtcctcggtggtaccccgcgtggtggaactgaacaagaactcgaacccggacgag
gtggtggtgcctctggacagcatggggaacccccgctgcgatggccaccagcagggttac
ccccgcaagtggaggactgatgacgccccgctctag

DBGET integrated database retrieval system