KEGG   Homo sapiens (human): 595Help
Entry
595               CDS       T01001                                 

Gene name
CCND1, BCL1, D11S287E, PRAD1, U21B31
Definition
cyclin D1
Orthology
K04503  
cyclin D1
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Viral myocarditis
Disease
H00006  
Hairy-cell leukemia
H00010  
Multiple myeloma
H00016  
Oral cancer
H00017  
Esophageal cancer
H00031  
Breast cancer
H00055  
Laryngeal cancer
H00559  
von Hippel-Lindau syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    595 (CCND1)
   04390 Hippo signaling pathway
    595 (CCND1)
   04630 Jak-STAT signaling pathway
    595 (CCND1)
   04068 FoxO signaling pathway
    595 (CCND1)
   04151 PI3K-Akt signaling pathway
    595 (CCND1)
   04152 AMPK signaling pathway
    595 (CCND1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    595 (CCND1)
   04115 p53 signaling pathway
    595 (CCND1)
  Cellular commiunity
   04510 Focal adhesion
    595 (CCND1)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    595 (CCND1)
   04921 Oxytocin signaling pathway
    595 (CCND1)
   04919 Thyroid hormone signaling pathway
    595 (CCND1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    595 (CCND1)
   05206 MicroRNAs in cancer
    595 (CCND1)
   05205 Proteoglycans in cancer
    595 (CCND1)
   05203 Viral carcinogenesis
    595 (CCND1)
   05210 Colorectal cancer
    595 (CCND1)
   05212 Pancreatic cancer
    595 (CCND1)
   05214 Glioma
    595 (CCND1)
   05216 Thyroid cancer
    595 (CCND1)
   05221 Acute myeloid leukemia
    595 (CCND1)
   05220 Chronic myeloid leukemia
    595 (CCND1)
   05218 Melanoma
    595 (CCND1)
   05219 Bladder cancer
    595 (CCND1)
   05215 Prostate cancer
    595 (CCND1)
   05213 Endometrial cancer
    595 (CCND1)
   05222 Small cell lung cancer
    595 (CCND1)
   05223 Non-small cell lung cancer
    595 (CCND1)
  Cardiovascular diseases
   05416 Viral myocarditis
    595 (CCND1)
  Infectious diseases
   05166 HTLV-I infection
    595 (CCND1)
   05162 Measles
    595 (CCND1)
   05161 Hepatitis B
    595 (CCND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 295 aa AA seqDB search
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgcaatgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc
tccatggtggcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system