KEGG   Homo sapiens (human): 597Help
Entry
597               CDS       T01001                                 

Gene name
BCL2A1, ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
Definition
(RefSeq) BCL2 related protein A1
  KO
K02162  
hematopoietic Bcl-2-related protein A1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Transcriptional misregulation in cancer
Drug target
Navitoclax: 
Navitoclax dihydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    597 (BCL2A1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    597 (BCL2A1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    597 (BCL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.3
AA seq 175 aa AA seqDB search
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacagactgtgaatttggatatatttacaggctggctcaggactatctgcagtgcgtc
ctacagataccacaacctggatcaggtccaagcaaaacgtccagagtgctacaaaatgtt
gcgttctcagtccaaaaagaagtggaaaagaatctgaagtcatgcttggacaatgttaat
gttgtgtccgtagacactgccagaacactattcaaccaagtgatggaaaaggagtttgaa
gacggcatcattaactggggaagaattgtaaccatatttgcatttgaaggtattctcatc
aagaaacttctacgacagcaaattgccccggatgtggatacctataaggagatttcatat
tttgttgcggagttcataatgaataacacaggagaatggataaggcaaaacggaggctgg
gaaaatggctttgtaaagaagtttgaacctaaatctggctggatgacttttctagaagtt
acaggaaagatctgtgaaatgctatctctcctgaagcaatactgttga

DBGET integrated database retrieval system