KEGG   Homo sapiens (human): 5970Help
Entry
5970              CDS       T01001                                 

Gene name
RELA, NFKB3, p65
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00221  HTLV-I Tax to host-cell-protein activation
N00267  HBV HBx to host-cell-protein activation
N00269  HCV Core to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5970 (RELA)
   04010 MAPK signaling pathway
    5970 (RELA)
   04064 NF-kappa B signaling pathway
    5970 (RELA)
   04668 TNF signaling pathway
    5970 (RELA)
   04066 HIF-1 signaling pathway
    5970 (RELA)
   04071 Sphingolipid signaling pathway
    5970 (RELA)
   04024 cAMP signaling pathway
    5970 (RELA)
   04151 PI3K-Akt signaling pathway
    5970 (RELA)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    5970 (RELA)
  Cell growth and death
   04210 Apoptosis
    5970 (RELA)
   04218 Cellular senescence
    5970 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5970 (RELA)
   04621 NOD-like receptor signaling pathway
    5970 (RELA)
   04622 RIG-I-like receptor signaling pathway
    5970 (RELA)
   04623 Cytosolic DNA-sensing pathway
    5970 (RELA)
   04625 C-type lectin receptor signaling pathway
    5970 (RELA)
   04660 T cell receptor signaling pathway
    5970 (RELA)
   04658 Th1 and Th2 cell differentiation
    5970 (RELA)
   04659 Th17 cell differentiation
    5970 (RELA)
   04657 IL-17 signaling pathway
    5970 (RELA)
   04662 B cell receptor signaling pathway
    5970 (RELA)
   04062 Chemokine signaling pathway
    5970 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    5970 (RELA)
   04917 Prolactin signaling pathway
    5970 (RELA)
   04926 Relaxin signaling pathway
    5970 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    5970 (RELA)
  Development
   04380 Osteoclast differentiation
    5970 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    5970 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5970 (RELA)
   05202 Transcriptional misregulation in cancers
    5970 (RELA)
   05203 Viral carcinogenesis
    5970 (RELA)
   05212 Pancreatic cancer
    5970 (RELA)
   05221 Acute myeloid leukemia
    5970 (RELA)
   05220 Chronic myeloid leukemia
    5970 (RELA)
   05215 Prostate cancer
    5970 (RELA)
   05222 Small cell lung cancer
    5970 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    5970 (RELA)
  Substance dependence
   05030 Cocaine addiction
    5970 (RELA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5970 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5970 (RELA)
   04931 Insulin resistance
    5970 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5970 (RELA)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5970 (RELA)
   05132 Salmonella infection
    5970 (RELA)
   05131 Shigellosis
    5970 (RELA)
   05133 Pertussis
    5970 (RELA)
   05134 Legionellosis
    5970 (RELA)
   05152 Tuberculosis
    5970 (RELA)
   05166 HTLV-I infection
    5970 (RELA)
   05162 Measles
    5970 (RELA)
   05164 Influenza A
    5970 (RELA)
   05161 Hepatitis B
    5970 (RELA)
   05160 Hepatitis C
    5970 (RELA)
   05168 Herpes simplex infection
    5970 (RELA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5970 (RELA)
   05169 Epstein-Barr virus infection
    5970 (RELA)
   05165 Human papillomavirus infection
    5970 (RELA)
   05146 Amoebiasis
    5970 (RELA)
   05145 Toxoplasmosis
    5970 (RELA)
   05140 Leishmaniasis
    5970 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    5970 (RELA)
  Drug resistance
   01523 Antifolate resistance
    5970 (RELA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5970 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 5970
NCBI-ProteinID: NP_068810
OMIM: 164014
HGNC: 9955
Ensembl: ENSG00000173039
Vega: OTTHUMG00000166566
Pharos: Q04206(Tchem)
UniProt: Q04206
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 551 aa AA seqDB search
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system