KEGG   Homo sapiens (human): 5970Help
Entry
5970              CDS       T01001                                 

Gene name
RELA, NFKB3, p65
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  
transcription factor p65
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Sphingolipid signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Longevity regulating pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Cocaine addiction
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5970 (RELA)
   04010 MAPK signaling pathway
    5970 (RELA)
   04064 NF-kappa B signaling pathway
    5970 (RELA)
   04668 TNF signaling pathway
    5970 (RELA)
   04066 HIF-1 signaling pathway
    5970 (RELA)
   04071 Sphingolipid signaling pathway
    5970 (RELA)
   04024 cAMP signaling pathway
    5970 (RELA)
   04151 PI3K-Akt signaling pathway
    5970 (RELA)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5970 (RELA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5970 (RELA)
   04621 NOD-like receptor signaling pathway
    5970 (RELA)
   04622 RIG-I-like receptor signaling pathway
    5970 (RELA)
   04623 Cytosolic DNA-sensing pathway
    5970 (RELA)
   04660 T cell receptor signaling pathway
    5970 (RELA)
   04662 B cell receptor signaling pathway
    5970 (RELA)
   04062 Chemokine signaling pathway
    5970 (RELA)
  Endocrine system
   04920 Adipocytokine signaling pathway
    5970 (RELA)
   04917 Prolactin signaling pathway
    5970 (RELA)
  Nervous system
   04722 Neurotrophin signaling pathway
    5970 (RELA)
  Development
   04380 Osteoclast differentiation
    5970 (RELA)
  Aging
   04211 Longevity regulating pathway - mammal
    5970 (RELA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5970 (RELA)
   05202 Transcriptional misregulation in cancers
    5970 (RELA)
   05203 Viral carcinogenesis
    5970 (RELA)
   05212 Pancreatic cancer
    5970 (RELA)
   05221 Acute myeloid leukemia
    5970 (RELA)
   05220 Chronic myeloid leukemia
    5970 (RELA)
   05215 Prostate cancer
    5970 (RELA)
   05222 Small cell lung cancer
    5970 (RELA)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    5970 (RELA)
  Substance dependence
   05030 Cocaine addiction
    5970 (RELA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5970 (RELA)
   04931 Insulin resistance
    5970 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5970 (RELA)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5970 (RELA)
   05132 Salmonella infection
    5970 (RELA)
   05131 Shigellosis
    5970 (RELA)
   05133 Pertussis
    5970 (RELA)
   05134 Legionellosis
    5970 (RELA)
   05152 Tuberculosis
    5970 (RELA)
   05166 HTLV-I infection
    5970 (RELA)
   05162 Measles
    5970 (RELA)
   05164 Influenza A
    5970 (RELA)
   05161 Hepatitis B
    5970 (RELA)
   05160 Hepatitis C
    5970 (RELA)
   05168 Herpes simplex infection
    5970 (RELA)
   05169 Epstein-Barr virus infection
    5970 (RELA)
   05146 Amoebiasis
    5970 (RELA)
   05145 Toxoplasmosis
    5970 (RELA)
   05140 Leishmaniasis
    5970 (RELA)
   05142 Chagas disease (American trypanosomiasis)
    5970 (RELA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5970 (RELA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 551 aa AA seqDB search
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system