KEGG   Homo sapiens (human): 5971Help
Entry
5971              CDS       T01001                                 

Gene name
RELB, I-REL, IREL, REL-B
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog B
Orthology
K09253  
transcription factor RelB
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5971 (RELB)
   04064 NF-kappa B signaling pathway
    5971 (RELB)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    5971 (RELB)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5971 (RELB)
   05169 Epstein-Barr virus infection
    5971 (RELB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5971 (RELB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.32
AA seq 579 aa AA seqDB search
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggtctgggccagcctctgggccgtccgtccccactggccgggccatgccgagt
cgccgcgtcgccagaccgccggctgcgccggagctgggggccttagggtcccccgacctc
tcctcactctcgctcgccgtttccaggagcacagatgaattggagatcatcgacgagtac
atcaaggagaacggcttcggcctggacgggggacagccgggcccgggcgaggggctgcca
cgcctggtgtctcgcggggctgcgtccctgagcacggtcaccctgggccctgtggcgccc
ccagccacgccgccgccttggggctgccccctgggccgactagtgtccccagcgccgggc
ccgggcccgcagccgcacctggtcatcacggagcagcccaagcagcgcggcatgcgcttc
cgctacgagtgcgagggccgctcggccggcagcatccttggggagagcagcaccgaggcc
agcaagacgctgcccgccatcgagctccgggattgtggagggctgcgggaggtggaggtg
actgcctgcctggtgtggaaggactggcctcaccgagtccacccccacagcctcgtgggg
aaagactgcaccgacggcatctgcagggtgcggctccggcctcacgtcagcccccggcac
agttttaacaacctgggcatccagtgtgtgaggaagaaggagattgaggctgccattgag
cggaagattcaactgggcattgacccctacaacgctgggtccctgaagaaccatcaggaa
gtagacatgaatgtggtgaggatctgcttccaggcctcatatcgggaccagcagggacag
atgcgccggatggatcctgtgctttccgagcccgtctatgacaagaaatccacaaacaca
tcagagctgcggatttgccgaattaacaaggaaagcgggccgtgcaccggtggcgaggag
ctctacttgctctgcgacaaggtgcagaaagaggacatatcagtggtgttcagcagggcc
tcctgggaaggtcgggctgacttctcccaggccgacgtgcaccgccagattgccattgtg
ttcaagacgccgccctacgaggacctggagattgtcgagcccgtgacagtcaacgtcttc
ctgcagcggctcaccgatggggtctgcagcgagccattgcctttcacgtacctgcctcgc
gaccatgacagctacggcgtggacaagaagcggaaacgggggatgcccgacgtccttggg
gagctgaacagctctgacccccatggcatcgagagcaaacggcggaagaaaaagccggcc
atcctggaccacttcctgcccaaccacggctcaggcccgttcctcccgccgtcagccctg
ctgccagaccctgacttcttctctggcaccgtgtccctgcccggcctggagccccctggc
gggcctgacctcctggacgatggctttgcctacgaccctacggcccccacactcttcacc
atgctggacctgctgcccccggcaccgccacacgctagcgctgttgtgtgcagcggaggt
gccggggccgtggttggggagacccccggccctgaaccactgacactggactcgtaccag
gccccgggccccggggatggaggcaccgccagccttgtgggcagcaacatgttccccaat
cattaccgcgaggcggcctttgggggcggcctcctatccccggggcctgaagccacgtag

DBGET integrated database retrieval system