KEGG   Homo sapiens (human): 599Help
Entry
599               CDS       T01001                                 

Gene name
BCL2L2, BCL-W, BCL2-L-2, BCLW, PPP1R51
Definition
(RefSeq) BCL2 like 2
  KO
K02163  
apoptosis regulator BCL-W
Organism
hsa  Homo sapiens (human)
Pathway
MicroRNAs in cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    599 (BCL2L2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     599 (BCL2L2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   599 (BCL2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2-q12
AA seq 193 aa AA seqDB search
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccagcctcggccccagacacacgggctctggtggcagactttgtaggttat
aagctgaggcagaagggttatgtctgtggagctggccccggggagggcccagcagctgac
ccgctgcaccaagccatgcgggcagctggagatgagttcgagacccgcttccggcgcacc
ttctctgatctggcggctcagctgcatgtgaccccaggctcagcccaacaacgcttcacc
caggtctccgatgaactttttcaagggggccccaactggggccgccttgtagccttcttt
gtctttggggctgcactgtgtgctgagagtgtcaacaaggagatggaaccactggtggga
caagtgcaggagtggatggtggcctacctggagacgcggctggctgactggatccacagc
agtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcgcgg
cgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactg
ggggccctggtaactgtaggggccttttttgctagcaagtga

DBGET integrated database retrieval system