KEGG   Homo sapiens (human): 60Help
Entry
60                CDS       T01001                                 

Gene name
ACTB, BRWS1, PS1TP5BP1
Definition
actin, beta
Orthology
K05692  
actin beta/gamma 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Phagosome
Hippo signaling pathway
Focal adhesion
Adherens junction
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Gastric acid secretion
Bacterial invasion of epithelial cells
Vibrio cholerae infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Influenza A
Proteoglycans in cancer
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00101  
Other phagocyte defects
H01255  
Juvenile-onset dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    60 (ACTB)
   04390 Hippo signaling pathway
    60 (ACTB)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    60 (ACTB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    60 (ACTB)
  Cellular commiunity
   04510 Focal adhesion
    60 (ACTB)
   04520 Adherens junction
    60 (ACTB)
   04530 Tight junction
    60 (ACTB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    60 (ACTB)
   04670 Leukocyte transendothelial migration
    60 (ACTB)
  Endocrine system
   04921 Oxytocin signaling pathway
    60 (ACTB)
   04919 Thyroid hormone signaling pathway
    60 (ACTB)
  Digestive system
   04971 Gastric acid secretion
    60 (ACTB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    60 (ACTB)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    60 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    60 (ACTB)
   05414 Dilated cardiomyopathy (DCM)
    60 (ACTB)
   05416 Viral myocarditis
    60 (ACTB)
  Infectious diseases
   05110 Vibrio cholerae infection
    60 (ACTB)
   05130 Pathogenic Escherichia coli infection
    60 (ACTB)
   05132 Salmonella infection
    60 (ACTB)
   05131 Shigellosis
    60 (ACTB)
   05100 Bacterial invasion of epithelial cells
    60 (ACTB)
   05164 Influenza A
    60 (ACTB)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     60 (ACTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    60 (ACTB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   60 (ACTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p22
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgtcgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcctatgtgggcgacgaggcccagagc
aagagaggcatcctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaaaatctggcaccacaccttctacaatgagctgcgtgtggctcccgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgttgctatccaggctgtgcta
tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcaccgagcgcggctacagcttc
accaccacggccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctacgtcgcc
ctggacttcgagcaagagatggccacggctgcttccagctcctccctggagaagagctac
gagctgcctgacggccaggtcatcaccattggcaatgagcggttccgctgccctgaggca
ctcttccagccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaac
tccatcatgaagtgtgacgtggacatccgcaaagacctgtacgccaacacagtgctgtct
ggcggcaccaccatgtaccctggcattgccgacaggatgcagaaggagatcactgccctg
gcacccagcacaatgaagatcaagatcattgctcctcctgagcgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system