KEGG   Homo sapiens (human): 60482Help
Entry
60482             CDS       T01001                                 

Gene name
SLC5A7, CHT, CHT1, HMN7A, hCHT
Definition
solute carrier family 5 (sodium/choline cotransporter), member 7
Orthology
K14387  
solute carrier family 5 (high affinity choline transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    60482 (SLC5A7)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    60482 (SLC5A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q12
AA seq 580 aa AA seqDB search
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggctttccatgtggaaggactgatagctatcatcgtgttctaccttctaattttgctg
gttggaatatgggctgcctggagaaccaaaaacagtggcagcgcagaagagcgcagcgaa
gccatcatagttggtggccgagatattggtttattggttggtggatttaccatgacagct
acctgggtcggaggagggtatatcaatggcacagctgaagcagtttatgtaccaggttat
ggcctagcttgggctcaggcaccaattggatattctcttagtctgattttaggtggcctg
ttctttgcaaaacctatgcgttcaaaggggtatgtgaccatgttagacccgtttcagcaa
atctatggaaaacgcatgggcggactcctgtttattcctgcactgatgggagaaatgttc
tgggctgcagcaattttctctgctttgggagccaccatcagcgtgatcatcgatgtggat
atgcacatttctgtcatcatctctgcactcattgccactctgtacacactggtgggaggg
ctctattctgtggcctacactgatgtcgttcagctcttttgcatttttgtagggctgtgg
atcagcgtcccctttgcattgtcacatcctgcagtcgcagacatcgggttcactgctgtg
catgccaaataccaaaagccgtggctgggaactgttgactcatctgaagtctactcttgg
cttgatagttttctgttgttgatgctgggtggaatcccatggcaagcatactttcagagg
gttctctcttcttcctcagccacctatgctcaagtgctgtccttcctggcagctttcggg
tgcctggtgatggccatcccagccatactcattggggccattggagcatcaacagactgg
aaccagactgcatatgggcttccagatcccaagactacagaagaggcagacatgatttta
ccaattgttctgcagtatctctgccctgtgtatatttctttctttggtcttggtgcagtt
tctgctgctgttatgtcatcagcagattcttccatcttgtcagcaagttccatgtttgca
cggaacatctaccagctttccttcagacaaaatgcttcggacaaagaaatcgtttgggtt
atgcgaatcacagtgtttgtgtttggagcatctgcaacagccatggccttgctgacgaaa
actgtgtatgggctctggtacctcagttctgaccttgtttacatcgttatcttcccccag
ctgctttgtgtactctttgttaagggaaccaacacctatggggccgtggcaggttatgtt
tctggcctcttcctgagaataactggaggggagccatatctgtatcttcagcccttgatc
ttctaccctggctattaccctgatgataatggtatatataatcagaaatttccatttaaa
acacttgccatggttacatcattcttaaccaacatttgcatctcctatctagccaagtat
ctatttgaaagtggaaccttgccacctaaattagatgtatttgatgctgttgttgcaaga
cacagtgaagaaaacatggataagacaattcttgtcaaaaatgaaaatattaaattagat
gaacttgcacttgtgaagccacgacagagcatgaccctcagctcaactttcaccaataaa
gaggccttccttgatgttgattccagtccagaagggtctgggactgaagataatttacag
tga

DBGET integrated database retrieval system