KEGG   Homo sapiens (human): 6092Help
Entry
6092              CDS       T01001                                 

Gene name
ROBO2, SAX3
Definition
roundabout, axon guidance receptor, homolog 2 (Drosophila)
Orthology
K06754  
roundabout, axon guidance receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H01037  
Vesicoureteral reflux
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6092 (ROBO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6092 (ROBO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p12.3
AA seq 1394 aa AA seqDB search
MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQGSRLRQEDFPPRIVEHPSDVIVSK
GEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPD
EGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPT
IYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFER
PTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTM
STDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPA
VFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKA
QLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPR
ATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGP
PSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRG
LRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNP
VVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKK
GVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPP
PDHQNGIIQEYKIWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGV
KSEPQPIIIGRRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRR
KKRKGLSNYAVTFQRGDGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNE
IGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILH
SNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKN
NGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEE
DDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQT
WHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSS
MDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPH
RREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIG
YMGSNSQGQFTGEL
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atggccagaagacatgaacgtgtcactagaaggatgtggacatgggctccgggactgttg
atgatgactgtggtgttttggggtcatcaggggaatggacaaggccaaggatcgcgtctt
cgccaggaggactttcccccgcggattgtggagcatccttccgatgtcatcgtctctaag
ggcgagcccacgactctgaactgcaaggcggagggccggccaacgcccaccattgagtgg
tacaaagatggggagcgagtggagactgacaaggacgatccccggtcccacaggatgctt
ctgcccagcggatccttattcttcttgcgcatcgtgcacgggcgcaggagtaaacctgat
gaaggaagctacgtttgtgttgcgaggaactatcttggtgaagcagtgagtcgaaatgcg
tctctggaagtggcattgttacgagatgacttccgacaaaaccccacagatgttgtagtg
gcagctggagagcctgcaatcctggagtgccagcctccccggggacacccagaacccacc
atctactggaaaaaagacaaagttcgaattgatgacaaggaagaaagaataagtatccgt
ggtggaaaactgatgatctccaataccaggaaaagtgatgcagggatgtatacttgtgtt
ggtaccaatatggtgggagaaagggacagtgacccagcagagctgactgtctttgaacga
cccacatttctcaggaggccaattaaccaggtggtactggaggaagaagctgtagaattt
cgttgtcaagtccaaggagatcctcaaccaactgtgaggtggaaaaaggatgatgcagac
ttgccaagaggaaggtatgacatcaaagacgattacacactaagaattaaaaagaccatg
agtacagatgaaggcacctatatgtgtattgctgagaatcgggttggaaaaatggaagcc
tctgctacactcaccgtccgagctcccccacagtttgtggttcggccaagagatcagatt
gttgctcaaggtcgaacagtgacatttccctgtgaaactaaaggaaacccacagccagct
gttttttggcagaaagaaggcagccagaacctacttttcccaaaccaaccccagcagccc
aacagtagatgctcagtgtcaccaactggagacctcacaatcaccaacattcaacgttcc
gacgcgggttactacatctgccaggctttaactgtggcaggaagcattttagcaaaagct
caactggaggttactgatgttttgacagatagacctccacctataattctacaaggccca
gccaaccaaacgctggcagtggatggtacagcgttactgaaatgtaaagccactggtgat
cctcttcctgtaattagctggttaaaggagggatttacttttccgggtagagatccaaga
gcaacaattcaagagcaaggcacactgcagattaagaatttacggatttctgatactggc
acttatacttgtgtggctacaagttcaagtggagagacttcctggagtgcagtgctggat
gtgacagagtctggagcaacaatcagtaaaaactatgatttaagtgacctgccagggcca
ccatccaaaccgcaggtcactgatgttactaagaacagtgtcaccttgtcctggcagcca
ggtacccctggaacccttccagcaagtgcatatatcattgaggctttcagccaatcagtg
agcaacagctggcagaccgtggcaaaccatgtaaagaccaccctctatactgtaagagga
ctgcggcccaatacaatctacttattcatggtcagagcgatcaacccccaaggtctcagt
gacccaagtcccatgtcagatcctgtgcgcacacaagatatcagcccaccagcacaagga
gtggaccacaggcaagtgcagaaagagctaggagatgtccttgtccgtcttcataatcca
gttgtgctgactcccaccacggttcaggtcacatggacggttgatcgccaaccccagttt
atccaaggctaccgagtgatgtatcgtcagacttcaggtctgcaggcgacatcttcgtgg
cagaatttagatgccaaagtcccgactgaacgaagtgctgtcttagtcaacctgaaaaag
ggggtgacttatgaaattaaagtacggccatattttaatgagttccaaggaatggatagt
gaatctaaaacggttcgtactactgaagaagccccaagtgccccaccacagtctgtcact
gtactgacagttggaagctacaatagcacaagtattagtgtttcctgggatcctcctcct
ccagatcaccagaatggaattatccaagaatacaagatctggtgtctaggaaatgaaacg
cgattccatatcaacaaaactgtggatgcagccattcggtccgtaataattggtggatta
ttcccaggtattcaataccgggtagaggttgcagctagtaccagtgcaggggttggagta
aagagtgagccacagccaataataatcgggagacgcaatgaagttgtcattactgaaaac
aataacagcataactgagcaaatcactgatgtggtgaagcaaccagcctttatagctggt
attggtggtgcctgctgggtaattctgatgggttttagcatatggttgtattggcgaaga
aagaagaggaagggactcagtaattatgctgttacgtttcaaagaggagatggaggacta
atgagcaatggaagccgtccaggtcttctcaatgctggtgatcccagctatccatggctt
gctgattcttggccagccacgagcttgccagtaaataatagcaacagtggcccaaatgag
attggaaattttggccgtggagatgtgctgccaccagttccaggccaaggggataaaaca
gcaacgatgctctcagatggagccatttatagtagcattgacttcactaccaaaaccagt
tacaacagttccagccaaataacacaggctaccccatatgccacgacacagatcttgcat
tccaacagcatacatgaattggctgtcgatctgcctgatccacaatggaaaagctcaatt
cagcaaaaaacagatctgatgggatttggttattctctacctgatcagaacaaaggtaac
aatggtgggaaaggtggaaaaaagaagaaaaataaaaactcttctaaaccacagaaaaac
aatggatccacttgggccaatgtccctctacctccccccccagtccagccccttcctggc
acggagctggaacactatgcagtggaacaacaagaaaatggctatgacagtgatagctgg
tgcccaccattgccagtacaaacttacttacaccaaggtctggaagatgaactggaagaa
gatgatgatagggtcccaacacctcctgttcgaggcgtggcttcttctcctgctatctcc
tttggacagcagtccactgcaactcttactccatccccacgggaagagatgcaacccatg
ctgcaggctcacctggatgagttgacaagagcctatcagtttgatatagcaaaacaaaca
tggcacattcaaagcaataatcaacctccacagcctccagttccaccgttaggttatgtg
tctggagccttgatttctgatttggaaacggatgttgcagatgatgatgccgacgacgaa
gaggaagctttagaaatccccaggcccctgagagcactggaccagactcctggatccagc
atggacaatctagacagctctgtgacaggaaaagcctttacctcctctcaaagacctcga
cctaccagcccattttctactgacagtaacaccagtgcagccctgagtcaaagtcagagg
cctcggcccactaaaaaacacaagggagggcggatggaccaacaaccagcattgcctcat
cgaagggaaggaatgacagatgaggaggccttggtgccctatagcaagcccagtttccca
tctccaggtggccacagctcatcaggaacagcttcttctaagggatccactggacctagg
aaaaccgaggtgttgagagcaggccaccagcgcaatgccagcgaccttcttgacatagga
tatatgggctccaacagtcaaggacagtttacaggtgaattatag

DBGET integrated database retrieval system