KEGG   Homo sapiens (human): 6092Help
Entry
6092              CDS       T01001                                 

Gene name
ROBO2, SAX3
Definition
(RefSeq) roundabout guidance receptor 2
  KO
K06754  
roundabout, axon guidance receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Disease
H01037  
Vesicoureteral reflux
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6092 (ROBO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6092 (ROBO2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/3 subfamily
    ROBO2; roundabout, axon guidance receptor 2 [KO:K06754]
     6092 (ROBO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p12.3
AA seq 1378 aa AA seqDB search
MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTP
TIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAV
SRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEER
ISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEE
AVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVG
KMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQ
PQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII
LQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRI
SDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
SWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINP
QGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDR
QPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQ
GMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCL
GNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVV
ITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRG
DGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQ
GDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQW
KSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQ
PLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASS
PAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPP
LGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSS
QRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSK
PSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctgatgtttacacaactactgctctgtggatttttatatgttcgggttgat
ggatcgcgtcttcgccaggaggactttcccccgcggattgtggagcatccttccgatgtc
atcgtctctaagggcgagcccacgactctgaactgcaaggcggagggccggccaacgccc
accattgagtggtacaaagatggggagcgagtggagactgacaaggacgatccccggtcc
cacaggatgcttctgcccagcggatccttattcttcttgcgcatcgtgcacgggcgcagg
agtaaacctgatgaaggaagctacgtttgtgttgcgaggaactatcttggtgaagcagtg
agtcgaaatgcgtctctggaagtggcattgttacgagatgacttccgacaaaaccccaca
gatgttgtagtggcagctggagagcctgcaatcctggagtgccagcctccccggggacac
ccagaacccaccatctactggaaaaaagacaaagttcgaattgatgacaaggaagaaaga
ataagtatccgtggtggaaaactgatgatctccaataccaggaaaagtgatgcagggatg
tatacttgtgttggtaccaatatggtgggagaaagggacagtgacccagcagagctgact
gtctttgaacgacccacatttctcaggaggccaattaaccaggtggtactggaggaagaa
gctgtagaatttcgttgtcaagtccaaggagatcctcaaccaactgtgaggtggaaaaag
gatgatgcagacttgccaagaggaaggtatgacatcaaagacgattacacactaagaatt
aaaaagaccatgagtacagatgaaggcacctatatgtgtattgctgagaatcgggttgga
aaaatggaagcctctgctacactcaccgtccgagctcccccacagtttgtggttcggcca
agagatcagattgttgctcaaggtcgaacagtgacatttccctgtgaaactaaaggaaac
ccacagccagctgttttttggcagaaagaaggcagccagaacctacttttcccaaaccaa
ccccagcagcccaacagtagatgctcagtgtcaccaactggagacctcacaatcaccaac
attcaacgttccgacgcgggttactacatctgccaggctttaactgtggcaggaagcatt
ttagcaaaagctcaactggaggttactgatgttttgacagatagacctccacctataatt
ctacaaggcccagccaaccaaacgctggcagtggatggtacagcgttactgaaatgtaaa
gccactggtgatcctcttcctgtaattagctggttaaaggagggatttacttttccgggt
agagatccaagagcaacaattcaagagcaaggcacactgcagattaagaatttacggatt
tctgatactggcacttatacttgtgtggctacaagttcaagtggagagacttcctggagt
gcagtgctggatgtgacagagtctggagcaacaatcagtaaaaactatgatttaagtgac
ctgccagggccaccatccaaaccgcaggtcactgatgttactaagaacagtgtcaccttg
tcctggcagccaggtacccctggaacccttccagcaagtgcatatatcattgaggctttc
agccaatcagtgagcaacagctggcagaccgtggcaaaccatgtaaagaccaccctctat
actgtaagaggactgcggcccaatacaatctacttattcatggtcagagcgatcaacccc
caaggtctcagtgacccaagtcccatgtcagatcctgtgcgcacacaagatatcagccca
ccagcacaaggagtggaccacaggcaagtgcagaaagagctaggagatgtccttgtccgt
cttcataatccagttgtgctgactcccaccacggttcaggtcacatggacggttgatcgc
caaccccagtttatccaaggctaccgagtgatgtatcgtcagacttcaggtctgcaggcg
acatcttcgtggcagaatttagatgccaaagtcccgactgaacgaagtgctgtcttagtc
aacctgaaaaagggggtgacttatgaaattaaagtacggccatattttaatgagttccaa
ggaatggatagtgaatctaaaacggttcgtactactgaagaagccccaagtgccccacca
cagtctgtcactgtactgacagttggaagctacaatagcacaagtattagtgtttcctgg
gatcctcctcctccagatcaccagaatggaattatccaagaatacaagatctggtgtcta
ggaaatgaaacgcgattccatatcaacaaaactgtggatgcagccattcggtccgtaata
attggtggattattcccaggtattcaataccgggtagaggttgcagctagtaccagtgca
ggggttggagtaaagagtgagccacagccaataataatcgggagacgcaatgaagttgtc
attactgaaaacaataacagcataactgagcaaatcactgatgtggtgaagcaaccagcc
tttatagctggtattggtggtgcctgctgggtaattctgatgggttttagcatatggttg
tattggcgaagaaagaagaggaagggactcagtaattatgctgttacgtttcaaagagga
gatggaggactaatgagcaatggaagccgtccaggtcttctcaatgctggtgatcccagc
tatccatggcttgctgattcttggccagccacgagcttgccagtaaataatagcaacagt
ggcccaaatgagattggaaattttggccgtggagatgtgctgccaccagttccaggccaa
ggggataaaacagcaacgatgctctcagatggagccatttatagtagcattgacttcact
accaaaaccagttacaacagttccagccaaataacacaggctaccccatatgccacgaca
cagatcttgcattccaacagcatacatgaattggctgtcgatctgcctgatccacaatgg
aaaagctcaattcagcaaaaaacagatctgatgggatttggttattctctacctgatcag
aacaaaggtaacaatggtgggaaaggtggaaaaaagaagaaaaataaaaactcttctaaa
ccacagaaaaacaatggatccacttgggccaatgtccctctacctccccccccagtccag
ccccttcctggcacggagctggaacactatgcagtggaacaacaagaaaatggctatgac
agtgatagctggtgcccaccattgccagtacaaacttacttacaccaaggtctggaagat
gaactggaagaagatgatgatagggtcccaacacctcctgttcgaggcgtggcttcttct
cctgctatctcctttggacagcagtccactgcaactcttactccatccccacgggaagag
atgcaacccatgctgcaggctcacctggatgagttgacaagagcctatcagtttgatata
gcaaaacaaacatggcacattcaaagcaataatcaacctccacagcctccagttccaccg
ttaggttatgtgtctggagccttgatttctgatttggaaacggatgttgcagatgatgat
gccgacgacgaagaggaagctttagaaatccccaggcccctgagagcactggaccagact
cctggatccagcatggacaatctagacagctctgtgacaggaaaagcctttacctcctct
caaagacctcgacctaccagcccattttctactgacagtaacaccagtgcagccctgagt
caaagtcagaggcctcggcccactaaaaaacacaagggagggcggatggaccaacaacca
gcattgcctcatcgaagggaaggaatgacagatgaggaggccttggtgccctatagcaag
cccagtttcccatctccaggtggccacagctcatcaggaacagcttcttctaagggatcc
actggacctaggaaaaccgaggtgttgagagcaggccaccagcgcaatgccagcgacctt
cttgacataggatatatgggctccaacagtcaaggacagtttacaggtgaattatag

DBGET integrated database retrieval system