KEGG   Homo sapiens (human): 6095Help
Entry
6095              CDS       T01001                                 

Gene name
RORA, NR1F1, ROR1, ROR2, ROR3, RZR-ALPHA, RZRA
Definition
(RefSeq) RAR related orphan receptor A
  KO
K08532  
RAR-related orphan receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Th17 cell differentiation
Circadian rhythm
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    6095 (RORA)
  Environmental adaptation
   04710 Circadian rhythm
    6095 (RORA)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6095 (RORA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    6095 (RORA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6095 (RORA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P35398(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.2
AA seq 523 aa AA seqDB search
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgagccaggcagcagcggcgcg
gacgcggccgccggctccagggagaccccgctgaaccaggaatccgcccgcaagagcgag
ccgcctgccccggtgcgcagacagagctattccagcaccagcagaggtatctcagtaacg
aagaagacacatacatctcaaattgaaattattccatgcaagatctgtggagacaaatca
tcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcaggagaagt
cagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcgaacc
agtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatgtctcga
gatgctgtaaaatttggccgaatgtcaaaaaagcagagagacagcttgtatgcagaagta
cagaaacaccggatgcagcagcagcagcgcgaccaccagcagcagcctggagaggctgag
ccgctgacgcccacctacaacatctcggccaacgggctgacggaacttcacgacgacctc
agtaactacattgacgggcacacccctgaggggagtaaggcagactccgccgtcagcagc
ttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatggaatcaaa
ccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttcgttcacc
aacggcgagacttccccaactgtgtccatggcagaattagaacaccttgcacagaatata
tctaaatcgcatctggaaacctgccaatacttgagagaagagctccagcagataacgtgg
cagacctttttacaggaagaaattgagaactatcaaaacaagcagcgggaggtgatgtgg
caattgtgtgccatcaaaattacagaagctatacagtatgtggtggagtttgccaaacgc
attgatggatttatggaactgtgtcaaaatgatcaaattgtgcttctaaaagcaggttct
ctagaggtggtgtttatcagaatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgatgggaagtatgccagccccgacgtcttcaaatccttaggttgtgaagactttatt
agctttgtgtttgaatttggaaagagtttatgttctatgcacctgactgaagatgaaatt
gcattattttctgcatttgtactgatgtcagcagatcgctcatggctgcaagaaaaggta
aaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctacagaagaat
caccgagaagatggaatactaacaaagttaatatgcaaggtgtctacattaagagcctta
tgtggacgacatacagaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccattatacaaggagttgttcacttcagaatttgagccagcaatgcaa
attgatgggtaa

DBGET integrated database retrieval system