KEGG   Homo sapiens (human): 6096Help
Entry
6096              CDS       T01001                                 

Gene name
RORB, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1
Definition
RAR-related orphan receptor B
Orthology
K08533  
RAR-related orphan receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    6096 (RORB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    6096 (RORB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6096 (RORB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
9q22
AA seq 459 aa AA seqDB search
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacaaattgaagtgataccatgcaaaatttgtggcgataagtcctctgggatc
cactacggagtcatcacatgtgaaggctgcaagggattctttaggaggagccagcagaac
aatgcttcttattcctgcccaaggcagagaaactgtttaattgacagaacgaacagaaac
cgttgccaacactgccgactgcagaagtgtcttgccctaggaatgtcaagagatgctgtg
aagtttgggaggatgtccaagaagcaaagggacagcctgtatgctgaggtgcagaagcac
cagcagcggctgcaggaacagcggcagcagcagagtggggaggcagaagcccttgccagg
gtgtacagcagcagcattagcaacggcctgagcaacctgaacaacgagaccagcggcact
tatgccaacgggcacgtcattgacctgcccaagtctgagggttattacaacgtcgattcc
ggtcagccgtcccctgatcagtcaggacttgacatgactggaatcaaacagataaagcaa
gaacctatctatgacctcacatccgtacccaacttgtttacctatagctctttcaacaat
gggcagttagcaccagggataaccatgactgaaatcgaccgaattgcacagaacatcatt
aagtcccatttggagacatgtcaatacaccatggaagagctgcaccagctggcgtggcag
acccacacctatgaagaaattaaagcatatcaaagcaagtccagggaagcactgtggcaa
caatgtgccatccagatcactcacgccatccaatacgtggtggagtttgcaaagcggata
acaggcttcatggagctctgtcaaaatgatcaaattctacttctgaagtcaggttgcttg
gaagtggttttagtgagaatgtgccgtgccttcaacccattaaacaacactgttctgttt
gaaggaaaatatggaggaatgcaaatgttcaaagccttaggttctgatgacctagtgaat
gaagcatttgactttgcaaagaatttgtgttccttgcagctgaccgaggaggagatcgct
ttgttctcatctgctgttctgatatctccagaccgagcctggcttatagaaccaaggaaa
gtccagaagcttcaggaaaaaatttattttgcacttcaacatgtgattcagaagaatcac
ctggatgatgagaccttggcaaagttaatagccaagataccaaccatcacggcagtttgc
aacttgcacggggagaagctgcaggtatttaagcaatctcatccagagatagtgaataca
ctgtttcctccgttatacaaggagctctttaatcctgactgtgccaccggctgcaaatga

DBGET integrated database retrieval system