KEGG   Homo sapiens (human): 6096Help
Entry
6096              CDS       T01001                                 

Gene name
RORB, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1
Definition
RAR-related orphan receptor B
Orthology
K08533  
RAR-related orphan receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Class
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
9q22
AA seq 459 aa AA seqDB search
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacaaattgaagtgataccatgcaaaatttgtggcgataagtcctctgggatc
cactacggagtcatcacatgtgaaggctgcaagggattctttaggaggagccagcagaac
aatgcttcttattcctgcccaaggcagagaaactgtttaattgacagaacgaacagaaac
cgttgccaacactgccgactgcagaagtgtcttgccctaggaatgtcaagagatgctgtg
aagtttgggaggatgtccaagaagcaaagggacagcctgtatgctgaggtgcagaagcac
cagcagcggctgcaggaacagcggcagcagcagagtggggaggcagaagcccttgccagg
gtgtacagcagcagcattagcaacggcctgagcaacctgaacaacgagaccagcggcact
tatgccaacgggcacgtcattgacctgcccaagtctgagggttattacaacgtcgattcc
ggtcagccgtcccctgatcagtcaggacttgacatgactggaatcaaacagataaagcaa
gaacctatctatgacctcacatccgtacccaacttgtttacctatagctctttcaacaat
gggcagttagcaccagggataaccatgactgaaatcgaccgaattgcacagaacatcatt
aagtcccatttggagacatgtcaatacaccatggaagagctgcaccagctggcgtggcag
acccacacctatgaagaaattaaagcatatcaaagcaagtccagggaagcactgtggcaa
caatgtgccatccagatcactcacgccatccaatacgtggtggagtttgcaaagcggata
acaggcttcatggagctctgtcaaaatgatcaaattctacttctgaagtcaggttgcttg
gaagtggttttagtgagaatgtgccgtgccttcaacccattaaacaacactgttctgttt
gaaggaaaatatggaggaatgcaaatgttcaaagccttaggttctgatgacctagtgaat
gaagcatttgactttgcaaagaatttgtgttccttgcagctgaccgaggaggagatcgct
ttgttctcatctgctgttctgatatctccagaccgagcctggcttatagaaccaaggaaa
gtccagaagcttcaggaaaaaatttattttgcacttcaacatgtgattcagaagaatcac
ctggatgatgagaccttggcaaagttaatagccaagataccaaccatcacggcagtttgc
aacttgcacggggagaagctgcaggtatttaagcaatctcatccagagatagtgaataca
ctgtttcctccgttatacaaggagctctttaatcctgactgtgccaccggctgcaaatga

DBGET integrated database retrieval system