KEGG   Homo sapiens (human): 6097Help
Entry
6097              CDS       T01001                                 

Gene name
RORC, NR1F3, RORG, RZR-GAMMA, RZRG, TOR
Definition
RAR-related orphan receptor C
Orthology
K08534  
RAR-related orphan receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Inflammatory bowel disease (IBD)
Class
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 497 aa AA seqDB search
MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGA
QGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCH
LEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPE
APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFSTETESPVGLSK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagaacacaaattgaagtgatcccttgcaaaatctgtggggacaagtcgtctgggatc
cactacggggttatcacctgtgaggggtgcaagggcttcttccgccggagccagcgctgt
aacgcggcctactcctgcacccgtcagcagaactgccccatcgaccgcaccagccgaaac
cgatgccagcactgccgcctgcagaaatgcctggcgctgggcatgtcccgagatgctgtc
aagttcggccgcatgtccaagaagcagagggacagcctgcatgcagaagtgcagaaacag
ctgcagcagcggcaacagcagcaacaggaaccagtggtcaagacccctccagcaggggcc
caaggagcagataccctcacctacaccttggggctcccagacgggcagctgcccctgggc
tcctcgcctgacctgcctgaggcttctgcctgtccccctggcctcctgaaagcctcaggc
tctgggccctcatattccaacaacttggccaaggcagggctcaatggggcctcatgccac
cttgaatacagccctgagcggggcaaggctgagggcagagagagcttctatagcacaggc
agccagctgacccctgaccgatgtggacttcgttttgaggaacacaggcatcctgggctt
ggggaactgggacagggcccagacagctacggcagccccagtttccgcagcacaccggag
gcaccctatgcctccctgacagagatagagcacctggtgcagagcgtctgcaagtcctac
agggagacatgccagctgcggctggaggacctgctgcggcagcgctccaacatcttctcc
cgggaggaagtgactggctaccagaggaagtccatgtgggagatgtgggaacggtgtgcc
caccacctcaccgaggccattcagtacgtggtggagttcgccaagaggctctcaggcttt
atggagctctgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagtggtg
ctggttaggatgtgccgggcctacaatgctgacaaccgcacggtcttttttgaaggcaaa
tacggtggcatggagctgttccgagccttgggctgcagcgagctcatcagctccatcttt
gacttctcccactccctaagtgccttgcacttttccgaggatgagattgccctctacaca
gcccttgttctcatcaatgcccatcggccagggctccaagagaaaaggaaagtagaacag
ctgcagtacaatctggagctggcctttcatcatcatctctgcaagactcatcgccaaagc
atcctggcaaagctgccacccaaggggaagcttcggagcctgtgtagccagcatgtggaa
aggctgcagatcttccagcacctccaccccatcgtggtccaagccgctttccctccactc
tacaaggagctcttcagcactgaaaccgagtcacctgtggggctgtccaagtga

DBGET integrated database retrieval system