KEGG   Homo sapiens (human): 6198Help
Entry
6198              CDS       T01001                                 

Gene name
RPS6KB1, PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70_S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
Definition
ribosomal protein S6 kinase, 70kDa, polypeptide 1 (EC:2.7.11.1)
Orthology
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
TGF-beta signaling pathway
Fc gamma R-mediated phagocytosis
Insulin signaling pathway
Proteoglycans in cancer
Acute myeloid leukemia
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    6198 (RPS6KB1)
   04350 TGF-beta signaling pathway
    6198 (RPS6KB1)
   04066 HIF-1 signaling pathway
    6198 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    6198 (RPS6KB1)
   04152 AMPK signaling pathway
    6198 (RPS6KB1)
   04150 mTOR signaling pathway
    6198 (RPS6KB1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    6198 (RPS6KB1)
  Endocrine system
   04910 Insulin signaling pathway
    6198 (RPS6KB1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6198 (RPS6KB1)
   05205 Proteoglycans in cancer
    6198 (RPS6KB1)
   05221 Acute myeloid leukemia
    6198 (RPS6KB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6198 (RPS6KB1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6198 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 502 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKAMIVRNAKDTAHTKAE
RNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEIS
MALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPE
ILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDL
LKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFD
SKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPR
TPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNS
GPYKKQAFPMISKRPEHLRMNL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagccccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggcaatgatagtaagaaatgctaaagatacagctcatacaaaagcagaa
cggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttatgcctttcag
actggtggaaaactctacctcatccttgagtatctcagtggaggagaactatttatgcag
ttagaaagagagggaatatttatggaagacactgcctgcttttacttggcagaaatctcc
atggctttggggcatttacatcaaaaggggatcatctacagagacctgaagccggagaat
atcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgcaaagaatct
attcatgatggaacagtcacacacacattttgtggaacaatagaatacatggcccctgaa
atcttgatgagaagtggccacaatcgtgctgtggattggtggagtttgggagcattaatg
tatgacatgctgactggagcacccccattcactggggagaatagaaagaaaacaattgac
aaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagccagagatctg
cttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcctggggacgct
ggagaagttcaagctcatccattctttagacacattaactgggaagaacttctggctcga
aaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagtcagtttgat
tccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctcagtgaaagt
gccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaaagtgtgaaa
gaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggcagcccacga
acacctgtcagcccagtcaaattttctcctggggatttctggggaagaggtgcttcggcc
agcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggcatagagcag
atggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacagccgaactct
gggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcacctgcgtatg
aatctatga

DBGET integrated database retrieval system