KEGG   Homo sapiens (human): 6198Help
Entry
6198              CDS       T01001                                 

Gene name
RPS6KB1, PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70_S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
Definition
ribosomal protein S6 kinase, 70kDa, polypeptide 1 (EC:2.7.11.1)
Orthology
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
TGF-beta signaling pathway
Fc gamma R-mediated phagocytosis
Insulin signaling pathway
Proteoglycans in cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    6198 (RPS6KB1)
   04350 TGF-beta signaling pathway
    6198 (RPS6KB1)
   04066 HIF-1 signaling pathway
    6198 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    6198 (RPS6KB1)
   04152 AMPK signaling pathway
    6198 (RPS6KB1)
   04150 mTOR signaling pathway
    6198 (RPS6KB1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    6198 (RPS6KB1)
  Endocrine system
   04910 Insulin signaling pathway
    6198 (RPS6KB1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6198 (RPS6KB1)
   05221 Acute myeloid leukemia
    6198 (RPS6KB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6198 (RPS6KB1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6198 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 502 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKAMIVRNAKDTAHTKAE
RNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEIS
MALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPE
ILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDL
LKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFD
SKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPR
TPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNS
GPYKKQAFPMISKRPEHLRMNL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagccccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggcaatgatagtaagaaatgctaaagatacagctcatacaaaagcagaa
cggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttatgcctttcag
actggtggaaaactctacctcatccttgagtatctcagtggaggagaactatttatgcag
ttagaaagagagggaatatttatggaagacactgcctgcttttacttggcagaaatctcc
atggctttggggcatttacatcaaaaggggatcatctacagagacctgaagccggagaat
atcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgcaaagaatct
attcatgatggaacagtcacacacacattttgtggaacaatagaatacatggcccctgaa
atcttgatgagaagtggccacaatcgtgctgtggattggtggagtttgggagcattaatg
tatgacatgctgactggagcacccccattcactggggagaatagaaagaaaacaattgac
aaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagccagagatctg
cttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcctggggacgct
ggagaagttcaagctcatccattctttagacacattaactgggaagaacttctggctcga
aaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagtcagtttgat
tccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctcagtgaaagt
gccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaaagtgtgaaa
gaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggcagcccacga
acacctgtcagcccagtcaaattttctcctggggatttctggggaagaggtgcttcggcc
agcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggcatagagcag
atggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacagccgaactct
gggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcacctgcgtatg
aatctatga

DBGET integrated database retrieval system