KEGG   Homo sapiens (human): 6198Help
Entry
6198              CDS       T01001                                 

Gene name
RPS6KB1, PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70_S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  
ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
ErbB signaling pathway
HIF-1 signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
TGF-beta signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Insulin signaling pathway
Insulin resistance
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Pancreatic cancer
Acute myeloid leukemia
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Choline metabolism in cancer
Network
N00039  
PDGF-PDGFR-PI3K signaling pathway
N00042  
EGFR-overexpression to PI3K signaling pathway
N00045  
KITLG-KIT-PI3K signaling pathway
N00049  
Mutation-activated PI3K to PI3K signaling pathway
N00050  
Amplified PI3K to PI3K signaling pathway
N00234  
IGF2-IGF1R-PI3K signaling pathway
N00236  
IGF2-overexpression to PI3K signaling pathway
N00238  
IGF1R-overexpression to PI3K signaling pathway
N00253  
Amplified ERBB2 to PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    6198 (RPS6KB1)
   04350 TGF-beta signaling pathway
    6198 (RPS6KB1)
   04371 Apelin signaling pathway
    6198 (RPS6KB1)
   04066 HIF-1 signaling pathway
    6198 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    6198 (RPS6KB1)
   04152 AMPK signaling pathway
    6198 (RPS6KB1)
   04150 mTOR signaling pathway
    6198 (RPS6KB1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    6198 (RPS6KB1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    6198 (RPS6KB1)
  Endocrine system
   04910 Insulin signaling pathway
    6198 (RPS6KB1)
  Aging
   04211 Longevity regulating pathway - mammal
    6198 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    6198 (RPS6KB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6198 (RPS6KB1)
   05231 Choline metabolism in cancer
    6198 (RPS6KB1)
   05205 Proteoglycans in cancer
    6198 (RPS6KB1)
   05212 Pancreatic cancer
    6198 (RPS6KB1)
   05225 Hepatocellular carcinoma
    6198 (RPS6KB1)
   05226 Gastric cancer
    6198 (RPS6KB1)
   05221 Acute myeloid leukemia
    6198 (RPS6KB1)
   05224 Breast cancer
    6198 (RPS6KB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6198 (RPS6KB1)
  Infectious diseases
   05165 Human papillomavirus infection
    6198 (RPS6KB1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    6198 (RPS6KB1)
   01522 Endocrine resistance
    6198 (RPS6KB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6198 (RPS6KB1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6198 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P23443(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.1
AA seq 525 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagccccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagctggtcct
ggggacgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtaagt
cagtttgattccaagtttacacgtcagacacctgtcgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggc
atagagcagatggatgtgacaatgagtggggaagcatcggcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system