KEGG   Homo sapiens (human): 623Help
Entry
623               CDS       T01001                                 

Gene name
BDKRB1, B1BKR, B1R, BKB1R, BKR1, BRADYB1
Definition
bradykinin receptor B1
Orthology
K03915  
bradykinin receptor B1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.1-q32.2
AA seq 353 aa AA seqDB search
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcctggccccctctagagctccaatcctccaaccagagccagctcttccct
caaaatgctacggcctgtgacaatgctccagaagcctgggacctgctgcacagagtgctg
ccaacatttatcatctccatctgtttcttcggcctcctagggaacctttttgtcctgttg
gtcttcctcctgccccggcggcaactgaacgtggcagaaatctacctggccaacctggca
gcctctgatctggtgtttgtcttgggcttgcccttctgggcagagaatatctggaaccag
tttaactggcctttcggagccctcctctgccgtgtcatcaacggggtcatcaaggccaat
ttgttcatcagcatcttcctggtggtggccatcagccaggaccgctaccgcgtgctggtg
caccctatggccagccggaggcagcagcggcggaggcaggcccgggtcacctgcgtgctc
atctgggttgtggggggcctcttgagcatccccacattcctgctgcgatccatccaagcc
gtcccagatctgaacatcaccgcctgcatcctgctcctcccccatgaggcctggcacttt
gcaaggattgtggagttaaatattctgggtttcctcctaccactggctgcgatcgtcttc
ttcaactaccacatcctggcctccctgcgaacgcgggaggaggtcagcaggacaaggtgc
gggggccgcaaggatagcaagaccacagcgctgatcctcacgctcgtggttgccttcctg
gtctgctgggccccttaccacttctttgccttcctggaattcttattccaggtgcaagca
gtccgaggctgcttttgggaggacttcattgacctgggcctgcaattggccaacttcttt
gccttcactaacagctccctgaatccagtaatttatgtctttgtgggccggctcttcagg
accaaggtctgggaactttataaacaatgcacccctaaaagtcttgctccaatatcttca
tcccataggaaagaaatcttccaacttttctggcggaattaa

DBGET integrated database retrieval system