KEGG   Homo sapiens (human): 6237Help
Entry
6237              CDS       T01001                                 

Gene name
RRAS
Definition
related RAS viral (r-ras) oncogene homolog
Orthology
K07829  
Ras-related protein R-Ras
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Tight junction
Regulation of actin cytoskeleton
HTLV-I infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    6237 (RRAS)
   04015 Rap1 signaling pathway
    6237 (RRAS)
   04010 MAPK signaling pathway
    6237 (RRAS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    6237 (RRAS)
  Cell communication
   04530 Tight junction
    6237 (RRAS)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6237 (RRAS)
  Infectious diseases
   05166 HTLV-I infection
    6237 (RRAS)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    6237 (RRAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 218 aa AA seqDB search
MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg
cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc
actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac
atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct
ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc
aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc
gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc
ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac
gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccg
agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system