KEGG   Homo sapiens (human): 6237Help
Entry
6237              CDS       T01001                                 

Gene name
RRAS
Definition
(RefSeq) related RAS viral (r-ras) oncogene homolog
  KO
K07829  
Ras-related protein R-Ras
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Axon guidance
Tight junction
Regulation of actin cytoskeleton
HTLV-I infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    6237 (RRAS)
   04015 Rap1 signaling pathway
    6237 (RRAS)
   04010 MAPK signaling pathway
    6237 (RRAS)
   04072 Phospholipase D signaling pathway
    6237 (RRAS)
   04024 cAMP signaling pathway
    6237 (RRAS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    6237 (RRAS)
  Cellular community - eukaryotes
   04530 Tight junction
    6237 (RRAS)
 Organismal Systems
  Development
   04360 Axon guidance
    6237 (RRAS)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6237 (RRAS)
  Infectious diseases
   05166 HTLV-I infection
    6237 (RRAS)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    6237 (RRAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 218 aa AA seqDB search
MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg
cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc
actattgaggactcctacacgaagatctgcagtgtggatggcatcccagcccggctggac
atcctggacaccgcgggccaggaagagttcggggccatgagagagcagtacatgcgtgct
ggccacggcttcctgctggtgttcgccattaacgaccggcagagtttcaacgaggtgggc
aagctcttcacgcagattctgcgggtcaaggaccgcgacgacttccccgttgtgttggtc
gggaacaaggcagatctggagtcacagcgccaggtcccccgatcagaagcctctgccttc
ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac
gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccg
agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system