KEGG   Homo sapiens (human): 6256Help
Entry
6256              CDS       T01001                                 

Gene name
RXRA, NR2B1
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Drug target
Alitretinoin: 
Bexarotene: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    6256 (RXRA)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    6256 (RXRA)
   03320 PPAR signaling pathway
    6256 (RXRA)
   04919 Thyroid hormone signaling pathway
    6256 (RXRA)
  Digestive system
   04976 Bile secretion
    6256 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6256 (RXRA)
   05202 Transcriptional misregulation in cancers
    6256 (RXRA)
   05216 Thyroid cancer
    6256 (RXRA)
   05222 Small cell lung cancer
    6256 (RXRA)
   05223 Non-small cell lung cancer
    6256 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6256 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    6256 (RXRA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    6256 (RXRA)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   6256 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 435 aa AA seqDB search
MAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
STGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHY
GVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTN
ICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLA
TGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPA
EVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAPHQMT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccctcgctgcacccgtccctggggcctggcatcggctccccgggacagctg
cattctcccatcagcaccctgagctcccccatcaacggcatgggcccgcctttctcggtc
atcagctcccccatgggcccccactccatgtcggtgcccaccacacccaccctgggcttc
agcactggcagcccccagctcagctcacctatgaaccccgtcagcagcagcgaggacatc
aagccccccctgggcctcaatggcgtcctcaaggtccccgcccacccctcaggaaacatg
gcttccttcaccaagcacatctgcgccatctgcggggaccgctcctcaggcaagcactat
ggagtgtacagctgcgaggggtgcaagggcttcttcaagcggacggtgcgcaaggacctg
acctacacctgccgcgacaacaaggactgcctgattgacaagcggcagcggaaccggtgc
cagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaagccgtgcaggag
gagcggcagcgtggcaaggaccggaacgagaatgaggtggagtcgaccagcagcgccaac
gaggacatgccggtggagaggatcctggaggctgagctggccgtggagcccaagaccgag
acctacgtggaggcaaacatggggctgaaccccagctcgccgaacgaccctgtcaccaac
atttgccaagcagccgacaaacagcttttcaccctggtggagtgggccaagcggatccca
cacttctcagagctgcccctggacgaccaggtcatcctgctgcgggcaggctggaatgag
ctgctcatcgcctccttctcccaccgctccatcgccgtgaaggacgggatcctcctggcc
accgggctgcacgtccaccggaacagcgcccacagcgcaggggtgggcgccatctttgac
agggtgctgacggagcttgtgtccaagatgcgggacatgcagatggacaagacggagctg
ggctgcctgcgcgccatcgtcctctttaaccctgactccaaggggctctcgaacccggcc
gaggtggaggcgctgagggagaaggtctatgcgtccttggaggcctactgcaagcacaag
tacccagagcagccgggaaggttcgctaagctcttgctccgcctgccggctctgcgctcc
atcgggctcaaatgcctggaacatctcttcttcttcaagctcatcggggacacacccatt
gacaccttccttatggagatgctggaggcgccgcaccaaatgacttag

DBGET integrated database retrieval system