KEGG   Homo sapiens (human): 6256Help
Entry
6256              CDS       T01001                                 

Gene name
RXRA, NR2B1
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Drug target
Alitretinoin: 
Bexarotene: 
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 462 aa AA seqDB search
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgatttctccacccaggtgaactcctccctcacc
tccccgacggggcgaggctccatggctgccccctcgctgcacccgtccctggggcctggc
atcggctccccgggacagctgcattctcccatcagcaccctgagctcccccatcaacggc
atgggcccgcctttctcggtcatcagctcccccatgggcccccactccatgtcggtgccc
accacacccaccctgggcttcagcactggcagcccccagctcagctcacctatgaacccc
gtcagcagcagcgaggacatcaagccccccctgggcctcaatggcgtcctcaaggtcccc
gcccacccctcaggaaacatggcttccttcaccaagcacatctgcgccatctgcggggac
cgctcctcaggcaagcactatggagtgtacagctgcgaggggtgcaagggcttcttcaag
cggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggactgcctgattgac
aagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatg
aagcgggaagccgtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtg
gagtcgaccagcagcgccaacgaggacatgccggtggagaggatcctggaggctgagctg
gccgtggagcccaagaccgagacctacgtggaggcaaacatggggctgaaccccagctcg
ccgaacgaccctgtcaccaacatttgccaagcagccgacaaacagcttttcaccctggtg
gagtgggccaagcggatcccacacttctcagagctgcccctggacgaccaggtcatcctg
ctgcgggcaggctggaatgagctgctcatcgcctccttctcccaccgctccatcgccgtg
aaggacgggatcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgca
ggggtgggcgccatctttgacagggtgctgacggagcttgtgtccaagatgcgggacatg
cagatggacaagacggagctgggctgcctgcgcgccatcgtcctctttaaccctgactcc
aaggggctctcgaacccggccgaggtggaggcgctgagggagaaggtctatgcgtccttg
gaggcctactgcaagcacaagtacccagagcagccgggaaggttcgctaagctcttgctc
cgcctgccggctctgcgctccatcgggctcaaatgcctggaacatctcttcttcttcaag
ctcatcggggacacacccattgacaccttccttatggagatgctggaggcgccgcaccaa
atgacttag

DBGET integrated database retrieval system