KEGG   Homo sapiens (human): 6300Help
Entry
6300              CDS       T01001                                 

Gene name
MAPK12, ERK-6, ERK3, ERK6, MAPK_12, P38GAMMA, PRKM12, SAPK-3, SAPK3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00689  MAPK (p38) signaling
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    6300 (MAPK12)
   04010 MAPK signaling pathway
    6300 (MAPK12)
   04370 VEGF signaling pathway
    6300 (MAPK12)
   04668 TNF signaling pathway
    6300 (MAPK12)
   04068 FoxO signaling pathway
    6300 (MAPK12)
   04071 Sphingolipid signaling pathway
    6300 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6300 (MAPK12)
   04218 Cellular senescence
    6300 (MAPK12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6300 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6300 (MAPK12)
   04620 Toll-like receptor signaling pathway
    6300 (MAPK12)
   04621 NOD-like receptor signaling pathway
    6300 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    6300 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    6300 (MAPK12)
   04660 T cell receptor signaling pathway
    6300 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    6300 (MAPK12)
   04659 Th17 cell differentiation
    6300 (MAPK12)
   04657 IL-17 signaling pathway
    6300 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    6300 (MAPK12)
   04670 Leukocyte transendothelial migration
    6300 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    6300 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    6300 (MAPK12)
   04917 Prolactin signaling pathway
    6300 (MAPK12)
   04926 Relaxin signaling pathway
    6300 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6300 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    6300 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    6300 (MAPK12)
   04722 Neurotrophin signaling pathway
    6300 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6300 (MAPK12)
  Development
   04380 Osteoclast differentiation
    6300 (MAPK12)
  Environmental adaptation
   04714 Thermogenesis
    6300 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6300 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    6300 (MAPK12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6300 (MAPK12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6300 (MAPK12)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6300 (MAPK12)
   05132 Salmonella infection
    6300 (MAPK12)
   05131 Shigellosis
    6300 (MAPK12)
   05133 Pertussis
    6300 (MAPK12)
   05152 Tuberculosis
    6300 (MAPK12)
   05164 Influenza A
    6300 (MAPK12)
   05160 Hepatitis C
    6300 (MAPK12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    6300 (MAPK12)
   05169 Epstein-Barr virus infection
    6300 (MAPK12)
   05145 Toxoplasmosis
    6300 (MAPK12)
   05140 Leishmaniasis
    6300 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    6300 (MAPK12)
  Drug resistance
   01522 Endocrine resistance
    6300 (MAPK12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6300 (MAPK12)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6300 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase Peripla_BP_5 UvrD_C
Motif
Other DBs
NCBI-GeneID: 6300
NCBI-ProteinID: NP_002960
OMIM: 602399
HGNC: 6874
Ensembl: ENSG00000188130
Vega: OTTHUMG00000030145
Pharos: P53778(Tchem)
UniProt: P53778
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 367 aa AA seqDB search
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacggccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cctttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcaggcgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgttgaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacgcctctgtga

DBGET integrated database retrieval system