KEGG   Homo sapiens (human): 6300Help
Entry
6300              CDS       T01001                                 

Gene name
MAPK12, ERK3, ERK6, P38GAMMA, PRKM12, SAPK-3, SAPK3
Definition
mitogen-activated protein kinase 12 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    6300 (MAPK12)
   04010 MAPK signaling pathway
    6300 (MAPK12)
   04370 VEGF signaling pathway
    6300 (MAPK12)
   04668 TNF signaling pathway
    6300 (MAPK12)
   04068 FoxO signaling pathway
    6300 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6300 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6300 (MAPK12)
   04620 Toll-like receptor signaling pathway
    6300 (MAPK12)
   04621 NOD-like receptor signaling pathway
    6300 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    6300 (MAPK12)
   04660 T cell receptor signaling pathway
    6300 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    6300 (MAPK12)
   04670 Leukocyte transendothelial migration
    6300 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    6300 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    6300 (MAPK12)
   04917 Prolactin signaling pathway
    6300 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6300 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    6300 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    6300 (MAPK12)
   04722 Neurotrophin signaling pathway
    6300 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6300 (MAPK12)
  Development
   04380 Osteoclast differentiation
    6300 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    6300 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    6300 (MAPK12)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6300 (MAPK12)
   05132 Salmonella infection
    6300 (MAPK12)
   05131 Shigellosis
    6300 (MAPK12)
   05133 Pertussis
    6300 (MAPK12)
   05152 Tuberculosis
    6300 (MAPK12)
   05164 Influenza A
    6300 (MAPK12)
   05160 Hepatitis C
    6300 (MAPK12)
   05169 Epstein-Barr virus infection
    6300 (MAPK12)
   05145 Toxoplasmosis
    6300 (MAPK12)
   05140 Leishmaniasis
    6300 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    6300 (MAPK12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6300 (MAPK12)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   6300 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 367 aa AA seqDB search
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacggccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcaggcgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgttgaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacgcctctgtga

DBGET integrated database retrieval system