KEGG   Homo sapiens (human): 6303Help
Entry
6303              CDS       T01001                                 

Gene name
SAT1, DC21, KFSD, KFSDX, SAT, SSAT, SSAT-1
Definition
spermidine/spermine N1-acetyltransferase 1 (EC:2.3.1.57)
Orthology
K00657  
diamine N-acetyltransferase [EC:2.3.1.57]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00750  
Keratosis follicularis spinulosa decalvans
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    6303 (SAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     6303 (SAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.1
AA seq 171 aa AA seqDB search
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcgtgatccgcccagccactgccgccgactgcagtgacatactgcggctg
atcaaggagctggctaaatatgaatacatggaagaacaagtaatcttaactgaaaaagat
ctgctagaagatggttttggagagcaccccttttaccactgcctggttgcagaagtgccg
aaagagcactggactccggaaggacacagcattgttggttttgccatgtactattttacc
tatgacccgtggattggcaagttattgtatcttgaggacttcttcgtgatgagtgattat
agaggctttggcataggatcagaaattctgaagaatctaagccaggttgcaatgaggtgt
cgctgcagcagcatgcacttcttggtagcagaatggaatgaaccatccatcaacttctat
aaaagaagaggtgcttctgatctgtccagtgaagagggttggagactgttcaagatcgac
aaggagtacttgctaaaaatggcaacagaggagtga

DBGET integrated database retrieval system