KEGG   Homo sapiens (human): 63036Help
Entry
63036             CDS       T01001                                 

Gene name
CELA2A, ELA2A, PE-1
Definition
chymotrypsin-like elastase family, member 2A (EC:3.4.21.71)
Orthology
K01346  
pancreatic elastase II [EC:3.4.21.71]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    63036 (CELA2A)
   04974 Protein digestion and absorption
    63036 (CELA2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     63036 (CELA2A)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   63036 (CELA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.21
AA seq 269 aa AA seqDB search
MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGG
SLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLV
VDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSR
LGCNYYHKPSVFTRVSNYIDWINSVIANN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgataaggacgctgctgctgtccactttggtggctggagccctcagttgtggggacccc
acttacccaccttatgtgactagggtggttggcggtgaagaagcgaggcccaacagctgg
ccctggcaggtctccctgcagtacagctccaatggcaagtggtaccacacctgcggaggg
tccctgatagccaacagctgggtcctgacggctgcccactgcatcagctcctccaggacc
taccgcgtggggctgggccggcacaacctctacgttgcggagtccggctcgctggcagtc
agtgtctctaagattgtggtgcacaaggactggaactccaaccaaatctccaaagggaac
gacattgccctgctcaaactggctaaccccgtctccctcaccgacaagatccagctggcc
tgcctccctcctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaacggggctgttcctgatgtcctgcagcagggccggttgctggtt
gtggactatgccacctgctccagctctgcctggtggggcagcagcgtgaaaaccagtatg
atctgtgctgggggtgatggcgtgatctccagctgcaacggagactctggcgggccactg
aactgtcaggcgtctgacggccggtggcaggtgcacggcatcgtcagcttcgggtctcgc
ctcggctgcaactactaccacaagccctccgtcttcacgcgggtctccaattacatcgac
tggatcaattcggtgattgcaaataactaa

DBGET integrated database retrieval system