KEGG   Homo sapiens (human): 6326Help
Entry
6326              CDS       T01001                                 

Gene name
SCN2A, BFIC3, BFIS3, BFNIS, EIEE11, HBA, HBSCI, HBSCII, NAC2, Na(v)1.2, Nav1.2, SCN2A1, SCN2A2
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 2
  KO
K04834  
voltage-gated sodium channel type II alpha
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Disease
H00606  
Early infantile epileptic encephalopathy
H00806  
Benign familial neonatal and infantile epilepsies
Drug target
Aminobenzoic acid (DG00379): 
Amiodarone (DG00204): 
Aprindine (DG00199): 
Benzocaine: 
Bupivacaine (DG00801): 
Carbamazepine: 
Chloroprocaine (DG00800): 
Cibenzoline (DG00209): 
Cocaine (DG00808): 
Disopyramide (DG00194): 
Eslicarbazepine (DG00848): 
Ethyl piperidinoacetylaminobenzoate (DG02445): 
Etidocaine (DG00804): 
Flecainide (DG00201): 
Fosphenytoin (DG00847): 
Lamotrigine: 
Levobupivacaine (DG00807): 
Lidocaine (DG00196): 
Mepivacaine (DG00802): 
Mexiletine (DG00197): 
Oxcarbazepine: 
Oxetacaine (DG00299): 
Phenytoin (DG00846): 
Pilsicainide (DG01257): 
Pirmenol (DG01381): 
Procainamide (DG00193): 
Procaine (DG00298): 
Propafenone (DG00200): 
Proxymetacaine (DG01145): 
Quinidine (DG00192): 
Riluzole: 
Ropivacaine (DG00806): 
Rufinamide: 
Tetracaine (DG00296): 
Topiramate: 
Zonisamide: 
p-Butylaminobenzoate (DG02381): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    6326 (SCN2A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6326 (SCN2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99250(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
2q24.3
AA seq 2005 aa AA seqDB search
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
STLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYL
LKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6018 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtcagtgctggtaccgccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctattgaacaacgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggatgaggatgatgaaaatggcccaaagccaaacagtgacttggaagcaggaaaa
tctcttccatttatttatggagacattcctccagagatggtgtcagtgcccctggaggat
ctggacccctactatatcaataagaaaacgtttatagtattgaataaagggaaagcaatc
tctcgattcagtgccacccctgccctttacattttaactcccttcaaccctattagaaaa
ttagctattaagattttggtacattctttattcaatatgctcattatgtgcacgattctt
accaactgtgtatttatgaccatgagtaaccctccagactggacaaagaatgtggagtat
acctttacaggaatttatacttttgaatcacttattaaaatacttgcaaggggcttttgt
ttagaagatttcacatttttacgggatccatggaattggttggatttcacagtcattact
tttgcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcaga
gttctccgagcattgaaaacaatttcagtcattccaggcctgaagaccattgtgggggcc
ctgatccagtcagtgaagaagctttctgatgtcatgatcttgactgtgttctgtctaagc
gtgtttgcgctaataggattgcagttgttcatgggcaacctacgaaataaatgtttgcaa
tggcctccagataattcttcctttgaaataaatatcacttccttctttaacaattcattg
gatgggaatggtactactttcaataggacagtgagcatatttaactgggatgaatatatt
gaggataaaagtcacttttattttttagaggggcaaaatgatgctctgctttgtggcaac
agctcagatgcaggccagtgtcctgaaggatacatctgtgtgaaggctggtagaaacccc
aactatggctacacgagctttgacacctttagttgggcctttttgtccttatttcgtctc
atgactcaagacttctgggaaaacctttatcaactgacactacgtgctgctgggaaaacg
tacatgatattttttgtgctggtcattttcttgggctcattctatctaataaatttgatc
ttggctgtggtggccatggcctatgaggaacagaatcaggccacattggaagaggctgaa
cagaaggaagctgaatttcagcagatgctcgaacagttgaaaaagcaacaagaagaagct
caggcggcagctgcagccgcatctgctgaatcaagagacttcagtggtgctggtgggata
ggagttttttcagagagttcttcagtagcatctaagttgagctccaaaagtgaaaaagag
ctgaaaaacagaagaaagaaaaagaaacagaaagaacagtctggagaagaagagaaaaat
gacagagtccgaaaatcggaatctgaagacagcataagaagaaaaggtttccgtttttcc
ttggaaggaagtaggctgacatatgaaaagagattttcttctccacaccagtccttactg
agcatccgtggctcccttttctctccaagacgcaacagtagggcgagccttttcagcttc
agaggtcgagcaaaggacattggctctgagaatgactttgctgatgatgagcacagcacc
tttgaggacaatgacagccgaagagactctctgttcgtgccgcacagacatggagaacgg
cgccacagcaatgtcagccaggccagccgtgcctccagggtgctccccatcctgcccatg
aatgggaagatgcatagcgctgtggactgcaatggtgtggtctccctggtcgggggccct
tctaccctcacatctgctgggcagctcctaccagagggcacaactactgaaacagaaata
agaaagagacggtccagttcttatcatgtttccatggatttattggaagatcctacatca
aggcaaagagcaatgagtatagccagtattttgaccaacaccatggaagaacttgaagaa
tccagacagaaatgcccaccatgctggtataaatttgctaatatgtgtttgatttgggac
tgttgtaaaccatggttaaaggtgaaacaccttgtcaacctggttgtaatggacccattt
gttgacctggccatcaccatctgcattgtcttaaatacactcttcatggctatggagcac
tatcccatgacggagcagttcagcagtgtactgtctgttggaaacctggtcttcacaggg
atcttcacagcagaaatgtttctcaagataattgccatggatccatattattactttcaa
gaaggctggaatatttttgatggttttattgtgagccttagtttaatggaacttggtttg
gcaaatgtggaaggattgtcagttctccgatcattccggctgctccgagttttcaagttg
gcaaaatcttggccaactctaaatatgctaattaagatcattggcaattctgtgggggct
ctaggaaacctcaccttggtattggccatcatcgtcttcatttttgctgtggtcggcatg
cagctctttggtaagagctacaaagaatgtgtctgcaagatttccaatgattgtgaactc
ccacgctggcacatgcatgactttttccactccttcctgatcgtgttccgcgtgctgtgt
ggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgcctt
actgtcttcatgatggtcatggtgattggaaatctagtggttctgaacctcttcttggcc
ttgcttttgagttccttcagttctgacaatcttgctgccactgatgatgataacgaaatg
aataatctccagattgctgtgggaaggatgcagaaaggaatcgattttgttaaaagaaaa
atacgtgaatttattcagaaagcctttgttaggaagcagaaagctttagatgaaattaaa
ccgcttgaagatctaaataataaaaaagacagctgtatttccaaccataccaccatagaa
ataggcaaagacctcaattatctcaaagacggaaatggaactactagtggcataggcagc
agtgtagaaaaatatgtcgtggatgaaagtgattacatgtcatttataaacaaccctagc
ctcactgtgacagtaccaattgctgttggagaatctgactttgaaaatttaaatactgaa
gaattcagcagcgagtcagatatggaggaaagcaaagagaagctaaatgcaactagttca
tctgaaggcagcacggttgatattggagctcccgccgagggagaacagcctgaggttgaa
cctgaggaatcccttgaacctgaagcctgttttacagaagactgtgtacggaagttcaag
tgttgtcagataagcatagaagaaggcaaagggaaactctggtggaatttgaggaaaaca
tgctataagatagtggagcacaattggttcgaaaccttcattgtcttcatgattctgctg
agcagtggggctctggcctttgaagatatatacattgagcagcgaaaaaccattaagacc
atgttagaatatgctgacaaggttttcacttacatattcattctggaaatgctgctaaag
tgggttgcatatggttttcaagtgtattttaccaatgcctggtgctggctagacttcctg
attgttgatgtctcactggttagcttaactgcaaatgccttgggttactcagaacttggt
gccatcaaatccctcagaacactaagagctctgaggccactgagagctttgtcccggttt
gaaggaatgagggttgttgtaaatgctcttttaggagccattccatctatcatgaatgta
cttctggtttgtctgatcttttggctaatattcagtatcatgggagtgaatctctttgct
ggcaagttttaccattgtattaattacaccactggagagatgtttgatgtaagcgtggtc
aacaactacagtgagtgcaaagctctcattgagagcaatcaaactgccaggtggaaaaat
gtgaaagtaaactttgataacgtaggacttggatatctgtctctacttcaagtagccacg
tttaagggatggatggatattatgtatgcagctgttgattcacgaaatgtagaattacaa
cccaagtatgaagacaacctgtacatgtatctttattttgtcatctttattatttttggt
tcattctttaccttgaatcttttcattggtgtcatcatagataacttcaaccaacagaaa
aagaagtttggaggtcaagacatttttatgacagaagaacagaagaaatactacaatgca
atgaaaaaactgggttcaaagaaaccacaaaaacccatacctcgacctgctaacaaattc
caaggaatggtctttgattttgtaaccaaacaagtctttgatatcagcatcatgatcctc
atctgccttaacatggtcaccatgatggtggaaaccgatgaccagagtcaagaaatgaca
aacattctgtactggattaatctggtgtttattgttctgttcactggagaatgtgtgctg
aaactgatctctcttcgttactactatttcactattggatggaatatttttgattttgtg
gtggtcattctctccattgtaggaatgtttctggctgaactgatagaaaagtattttgtg
tcccctaccctgttccgagtgatccgtcttgccaggattggccgaatcctacgtctgatc
aaaggagcaaaggggatccgcacgctgctctttgctttgatgatgtcccttcctgcgttg
tttaacatcggcctccttcttttcctggtcatgttcatctacgccatctttgggatgtcc
aattttgcctatgttaagagggaagttgggatcgatgacatgttcaactttgagaccttt
ggcaacagcatgatctgcctgttccaaattacaacctctgctggctgggatggattgcta
gcacctattcttaatagtggacctccagactgtgaccctgacaaagatcaccctggaagc
tcagttaaaggagactgtgggaacccatctgttgggattttcttttttgtcagttacatc
atcatatccttcctggttgtggtgaacatgtacatcgcggtcatcctggagaacttcagt
gttgctactgaagaaagtgcagagcctctgagtgaggatgactttgagatgttctatgag
gtttgggagaagtttgatcccgatgcgacccagtttatagagtttgccaaactttctgat
tttgcagatgccctggatcctcctcttctcatagcaaaacccaacaaagtccagctcatt
gccatggatctgcccatggtgagtggtgaccggatccactgtcttgacatcttatttgct
tttacaaagcgtgttttgggtgagagtggagagatggatgcccttcgaatacagatggaa
gagcgattcatggcatcaaacccctccaaagtctcttatgagcccattacgaccacgttg
aaacgcaaacaagaggaggtgtctgctattattatccagagggcttacagacgctacctc
ttgaagcaaaaagttaaaaaggtatcaagtatatacaagaaagacaaaggcaaagaatgt
gatggaacacccatcaaagaagatactctcattgataaactgaatgagaattcaactcca
gagaaaaccgatatgacgccttccaccacgtctccaccctcgtatgatagtgtgaccaaa
ccagaaaaagaaaaatttgaaaaagacaaatcagaaaaggaagacaaagggaaagatatc
agggaaagtaaaaagtaa

DBGET integrated database retrieval system