KEGG   Homo sapiens (human): 6327Help
Entry
6327              CDS       T01001                                 

Gene name
SCN2B, ATFB14
Definition
(RefSeq) sodium voltage-gated channel beta subunit 2
  KO
K04846  
voltage-gated sodium channel type II beta
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN beta
   6327 (SCN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 215 aa AA seqDB search
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagatgcctggctacctcgccctgccttcagcctcacggggctcagtctcttt
ttctctttggtgccaccaggacggagcatggaggtcacagtacctgccaccctcaacgtc
ctcaatggctctgacgcccgcctgccctgcaccttcaactcctgctacacagtgaaccac
aaacagttctccctgaactggacttaccaggagtgcaacaactgctctgaggagatgttc
ctccagttccgcatgaagatcattaacctgaagctggagcggtttcaagaccgcgtggag
ttctcagggaaccccagcaagtacgatgtgtcggtgatgctgagaaacgtgcagccggag
gatgaggggatttacaactgctacatcatgaacccccctgaccgccaccgtggccatggc
aagatccatctgcaggtcctcatggaagagccccctgagcgggactccacggtggccgtg
attgtgggtgcctccgtcgggggcttcctggctgtggtcatcttggtgctgatggtggtc
aagtgtgtgaggagaaaaaaagagcagaagctgagcacagatgacctgaagaccgaggag
gagggcaagacggacggtgaaggcaacccggatgatggcgccaagtag

DBGET integrated database retrieval system