KEGG   Homo sapiens (human): 6328Help
Entry
6328              CDS       T01001                                 

Gene name
SCN3A, NAC3, Nav1.3
Definition
sodium channel, voltage-gated, type III, alpha subunit
Orthology
K04836  
voltage-gated sodium channel type III alpha
Organism
hsa  Homo sapiens (human)
Drug target
Quinidine: 
Procainamide: 
Disopyramide: 
Ajmaline: 
Lidocaine: 
Mexiletine: 
Tocainide: 
Aprindine: 
Propafenone: 
Flecainide: 
Encainide: 
Bunaftine: 
Moracizine: 
Cibenzoline: 
Tetracaine: 
Benzocaine: 
Cinchocaine: 
Procaine: 
Chloroprocaine: 
Bupivacaine: 
Mepivacaine: 
Prilocaine: 
Ropivacaine: 
Levobupivacaine: 
Cocaine: 
Dyclonine: 
Phenytoin: 
Mephenytoin: 
Fosphenytoin: 
Carbamazepine: 
Oxcarbazepine: 
Eslicarbazepine: 
Lamotrigine: 
Topiramate: 
Zonisamide: 
Ambroxol: 
Proxymetacaine: 
Other: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6328 (SCN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24
AA seq 1951 aa AA seqDB search
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIA
SILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITIC
IVLNTLFMAMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDG
IIVSLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMW
DCMEVAGQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVG
RMQKGIDYVKNKMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNG
TTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEES
KEKLNATSSSEGSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKG
KIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTY
IFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRAL
RPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTT
GNMFDISDVNNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDS
RDVKLQPVYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDD
QGKYMTLVLSRINLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEM
IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIY
AIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPD
TIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDD
FEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHC
LDILFAFTKRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQR
NFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPS
YDSVTKPDKEKFEKDKPEKESKGKEVRENQK
NT seq 5856 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcactgttggtacccccaggacctgaaagcttccgcctttttactagagaa
tctcttgctgctatcgaaaaacgtgctgcagaagagaaagccaagaagcccaaaaaggaa
caagataatgatgatgagaacaaaccaaagccaaatagtgacttggaagctggaaagaac
cttccatttatttatggagacattcctccagagatggtgtcagagcccctggaggacctg
gatccctactatatcaataagaaaacttttatagtaatgaataaaggaaaggcaattttc
cgattcagtgccacctctgccttgtatattttaactccactaaaccctgttaggaaaatt
gctatcaagattttggtacattctttattcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgaccttgagcaaccctcctgactggacaaagaatgtagagtacaca
ttcactggaatctatacctttgagtcacttataaaaatcttggcaagagggttttgctta
gaagattttacgtttcttcgtgatccatggaactggctggatttcagtgtcattgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcagagtt
ctccgagcactgaaaacaatttcagtcattccaggtttaaagaccattgtgggggccctg
atccagtcggtaaagaagctttctgatgtgatgatcctgactgtgttctgtctgagcgtg
tttgctctcattgggctgcagctgttcatgggcaatctgaggaataaatgtttgcagtgg
cccccaagcgattctgcttttgaaaccaacaccacttcctactttaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcacatttaactggaaggattacattgga
gatgacagtcacttttatgttttggatgggcaaaaagaccctttactctgtggaaatggc
tcagatgcaggccagtgtccagaaggatacatctgtgtgaaggctggtcgaaaccccaac
tatggctacacaagctttgacacctttagctgggctttcctgtctctatttcgactcatg
actcaagactactgggaaaatctttaccagttgacattacgtgctgctgggaaaacatac
atgatattttttgtcctggtcattttcttgggctcattttatttggtgaatttgatcctg
gctgtggtggccatggcctatgaggagcagaatcaggccaccttggaagaagcagaacaa
aaagaggccgaatttcagcagatgctcgaacagcttaaaaagcaacaggaagaagctcag
gcagttgcggcagcatcagctgcttcaagagatttcagtggaataggtgggttaggagag
ctgttggaaagttcttcagaagcatcaaagttgagttccaaaagtgctaaagaatggagg
aaccgaaggaagaaaagaagacagagagagcaccttgaaggaaacaacaaaggagagaga
gacagctttcccaaatccgaatctgaagacagcgtcaaaagaagcagcttccttttctcc
atggatggaaacagactgaccagtgacaaaaaattctgctcccctcatcagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacaagcattttcagtttc
agaggtcgggcaaaggatgttggatctgaaaatgactttgctgatgatgaacacagcaca
tttgaagacagcgaaagcaggagagactcactgtttgtgccgcacagacatggagagcga
cgcaacagtaacggcaccaccacagaaacggaagtcagaaagagaaggttaagctcttac
cagatttcaatggagatgctggaggattcctctggaaggcaaagagccgtgagcatagcc
agcattctgaccaacacaatggaagaacttgaagaatctagacagaaatgtccgccatgc
tggtatagatttgccaatgtgttcttgatctgggactgctgtgatgcatggttaaaagta
aaacatcttgtgaatttaattgttatggatccatttgttgatcttgccatcactatttgc
attgtcttaaataccctctttatggccatggagcactaccccatgactgagcaattcagt
agtgtgttgactgtaggaaacctggtctttactgggattttcacagcagaaatggttctc
aagatcattgccatggatccttattactatttccaagaaggctggaatatctttgatgga
attattgtcagcctcagtttaatggagcttggtctgtcaaatgtggagggattgtctgta
ctgcgatcattcagactgcttagagttttcaagttggcaaaatcctggcccacactaaat
atgctaattaagatcattggcaattctgtgggggctctaggaaacctcaccttggtgttg
gccatcatcgtcttcatttttgctgtggtcggcatgcagctctttggtaagagctacaaa
gaatgtgtctgcaagatcaatgatgactgtacgctcccacggtggcacatgaacgacttc
ttccactccttcctgattgtgttccgcgtgctgtgtggagagtggatagagaccatgtgg
gactgtatggaggtcgctggccaaaccatgtgccttattgttttcatgttggtcatggtc
attggaaaccttgtggttctgaacctctttctggccttattgttgagttcatttagctca
gacaaccttgctgctactgatgatgacaatgaaatgaataatctgcagattgcagtagga
agaatgcaaaagggaattgattatgtgaaaaataagatgcgggagtgtttccaaaaagcc
ttttttagaaagccaaaagttatagaaatccatgaaggcaataagatagacagctgcatg
tccaataatactggaattgaaataagcaaagagcttaattatcttagagatgggaatgga
accaccagtggtgtaggtactggaagcagtgttgaaaaatacgtaatcgatgaaaatgat
tatatgtcattcataaacaaccccagcctcaccgtcacagtgccaattgctgttggagag
tctgactttgaaaacttaaatactgaagagttcagcagtgagtcagaactagaagaaagc
aaagagaaattaaatgcaaccagctcatctgaaggaagcacagttgatgttgttctaccc
cgagaaggtgaacaagctgaaactgaacccgaagaagaccttaaaccggaagcttgtttt
actgaaggatgtattaaaaagtttccattctgtcaagtaagtacagaagaaggcaaaggg
aagatctggtggaatcttcgaaaaacctgctacagtattgttgagcacaactggtttgag
actttcattgtgttcatgatccttctcagtagtggtgcattggcctttgaagatatatac
attgaacagcgaaagactatcaaaaccatgctagaatatgctgacaaagtctttacctat
atattcattctggaaatgcttctcaaatgggttgcttatggatttcaaacatatttcact
aatgcctggtgctggctagatttcttgatcgttgatgtttctttggttagcctggtagcc
aatgctcttggctactcagaactcggtgccatcaaatcattacggacattaagagcttta
agacctctaagagccttatcccggtttgaaggcatgagggtggttgtgaatgctcttgtt
ggagcaattccctctatcatgaatgtgctgttggtctgtctcatcttctggttgatcttt
agcatcatgggtgtgaatttgtttgctggcaagttctaccactgtgttaacatgacaacg
ggtaacatgtttgacattagtgatgttaacaatttgagtgactgtcaggctcttggcaag
caagctcggtggaaaaacgtgaaagtaaactttgataatgttggcgctggctatcttgca
ctgcttcaagtggccacatttaaaggctggatggatattatgtatgcagctgttgattca
cgagatgttaaacttcagcctgtatatgaagaaaatctgtacatgtatttatactttgtc
atctttatcatctttgggtcattcttcactctgaatctattcattggtgtcatcatagat
aacttcaaccagcagaaaaagaagtttggaggtcaagacatctttatgacagaggaacag
aaaaaatattacaatgcaatgaagaaacttggatccaagaaacctcagaaacccatacct
cgcccagcaaacaaattccaaggaatggtctttgattttgtaaccagacaagtctttgat
atcagcatcatgatcctcatctgcctcaacatggtcaccatgatggtggaaacggatgac
cagggcaaatacatgaccctagttttgtcccggatcaacctagtgttcattgttctgttc
actggagaatttgtgctgaagctcgtctccctcagacactactacttcactataggctgg
aacatctttgactttgtggtggtgattctctccattgtaggtatgtttctggctgagatg
atagaaaagtattttgtgtcccctaccttgttccgagtgatccgtcttgccaggattggc
cgaatcctacgtctgatcaaaggagcaaaggggatccgcacgctgctctttgctttgatg
atgtcccttcctgcgttgtttaacatcggcctcctgctcttcctggtcatgtttatctat
gccatctttgggatgtccaactttgcctatgttaaaaaggaagctggaattgatgacatg
ttcaactttgagacctttggcaacagcatgatctgcttgttccaaattacaacctctgct
ggctgggatggattgctagcacctattcttaatagtgcaccacccgactgtgaccctgac
acaattcaccctggcagctcagttaagggagactgtgggaacccatctgttgggattttc
ttttttgtcagttacatcatcatatccttcctggttgtggtgaacatgtacatcgcggtc
atcctggagaacttcagtgttgctactgaagaaagtgcagagcccctgagtgaggatgac
tttgagatgttctatgaggtttgggaaaagtttgatcccgatgcgacccagtttatagag
ttctctaaactctctgattttgcagctgccctggatcctcctcttctcatagcaaaaccc
aacaaagtccagcttattgccatggatctgcccatggtcagtggtgaccggatccactgt
cttgatattttatttgcctttacaaagcgtgttttgggtgagagtggagagatggatgcc
cttcgaatacagatggaagacaggtttatggcatcaaacccctccaaagtctcttatgag
cctattacaaccactttgaaacgtaaacaagaggaggtgtctgccgctatcattcagcgt
aatttcagatgttatcttttaaagcaaaggttaaaaaatatatcaagtaactataacaaa
gaggcaattaaagggaggattgacttacctataaaacaagacatgattattgacaaacta
aatgggaactccactccagaaaaaacagatgggagttcctctaccacctctcctccttcc
tatgatagtgtaacaaaaccagacaaggaaaagtttgagaaagacaaaccagaaaaagaa
agcaaaggaaaagaggtcagagaaaatcaaaagtaa

DBGET integrated database retrieval system