KEGG   Homo sapiens (human): 6328Help
Entry
6328              CDS       T01001                                 

Gene name
SCN3A, NAC3, Nav1.3
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 3
  KO
K04836  
voltage-gated sodium channel type III alpha
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Drug target
Quinidine [DG:DG00192]: 
Procainamide [DG:DG00193]: 
Disopyramide [DG:DG00194]: 
Ajmaline: 
Lidocaine [DG:DG00196]: 
Mexiletine [DG:DG00197]: 
Tocainide [DG:DG00198]: 
Aprindine [DG:DG00199]: 
Propafenone [DG:DG00200]: 
Flecainide [DG:DG00201]: 
Encainide [DG:DG00203]: 
Bunaftine: 
Moracizine [DG:DG00208]: 
Cibenzoline [DG:DG00209]: 
Tetracaine [DG:DG00296]: 
Benzocaine: 
Cinchocaine [DG:DG00297]: 
Procaine [DG:DG00298]: 
Aminobenzoic acid [DG:DG00379]: 
Chloroprocaine [DG:DG00800]: 
Bupivacaine [DG:DG00801]: 
Mepivacaine [DG:DG00802]: 
Prilocaine [DG:DG00803]: 
Ropivacaine [DG:DG00806]: 
Levobupivacaine [DG:DG00807]: 
Cocaine [DG:DG00808]: 
Dyclonine [DG:DG00809]: 
Phenytoin [DG:DG00846]: 
Mephenytoin: 
Fosphenytoin [DG:DG00847]: 
Carbamazepine: 
Oxcarbazepine: 
Eslicarbazepine [DG:DG00848]: 
Lamotrigine: 
Topiramate: 
Zonisamide: 
Ambroxol [DG:DG01073]: 
Proxymetacaine [DG:DG01145]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    6328 (SCN3A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6328 (SCN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24
AA seq 2000 aa AA seqDB search
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGP
SALTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
KMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKTCY
SIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWV
AYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDISDVNN
LSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEE
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLVLSR
INLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLF
RVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV
KKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSVKGD
CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKF
DPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRV
LGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRL
KNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEK
FEKDKPEKESKGKEVRENQK
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcactgttggtacccccaggacctgaaagcttccgcctttttactagagaa
tctcttgctgctatcgaaaaacgtgctgcagaagagaaagccaagaagcccaaaaaggaa
caagataatgatgatgagaacaaaccaaagccaaatagtgacttggaagctggaaagaac
cttccatttatttatggagacattcctccagagatggtgtcagagcccctggaggacctg
gatccctactatatcaataagaaaacttttatagtaatgaataaaggaaaggcaattttc
cgattcagtgccacctctgccttgtatattttaactccactaaaccctgttaggaaaatt
gctatcaagattttggtacattctttattcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgaccttgagcaaccctcctgactggacaaagaatgtagagtacaca
ttcactggaatctatacctttgagtcacttataaaaatcttggcaagagggttttgctta
gaagattttacgtttcttcgtgatccatggaactggctggatttcagtgtcattgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcagagtt
ctccgagcactgaaaacaatttcagtcattccaggtttaaagaccattgtgggggccctg
atccagtcggtaaagaagctttctgatgtgatgatcctgactgtgttctgtctgagcgtg
tttgctctcattgggctgcagctgttcatgggcaatctgaggaataaatgtttgcagtgg
cccccaagcgattctgcttttgaaaccaacaccacttcctactttaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcacatttaactggaaggattacattgga
gatgacagtcacttttatgttttggatgggcaaaaagaccctttactctgtggaaatggc
tcagatgcaggccagtgtccagaaggatacatctgtgtgaaggctggtcgaaaccccaac
tatggctacacaagctttgacacctttagctgggctttcctgtctctatttcgactcatg
actcaagactactgggaaaatctttaccagttgacattacgtgctgctgggaaaacatac
atgatattttttgtcctggtcattttcttgggctcattttatttggtgaatttgatcctg
gctgtggtggccatggcctatgaggagcagaatcaggccaccttggaagaagcagaacaa
aaagaggccgaatttcagcagatgctcgaacagcttaaaaagcaacaggaagaagctcag
gcagttgcggcagcatcagctgcttcaagagatttcagtggaataggtgggttaggagag
ctgttggaaagttcttcagaagcatcaaagttgagttccaaaagtgctaaagaatggagg
aaccgaaggaagaaaagaagacagagagagcaccttgaaggaaacaacaaaggagagaga
gacagctttcccaaatccgaatctgaagacagcgtcaaaagaagcagcttccttttctcc
atggatggaaacagactgaccagtgacaaaaaattctgctcccctcatcagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacaagcattttcagtttc
agaggtcgggcaaaggatgttggatctgaaaatgactttgctgatgatgaacacagcaca
tttgaagacagcgaaagcaggagagactcactgtttgtgccgcacagacatggagagcga
cgcaacagtaacgttagtcaggccagtatgtcatccaggatggtgccagggcttccagca
aatgggaagatgcacagcactgtggattgcaatggtgtggtttccttggtgggtggacct
tcagctctaacgtcacctactggacaacttcccccagagggcaccaccacagaaacggaa
gtcagaaagagaaggttaagctcttaccagatttcaatggagatgctggaggattcctct
ggaaggcaaagagccgtgagcatagccagcattctgaccaacacaatggaagaacttgaa
gaatctagacagaaatgtccgccatgctggtatagatttgccaatgtgttcttgatctgg
gactgctgtgatgcatggttaaaagtaaaacatcttgtgaatttaattgttatggatcca
tttgttgatcttgccatcactatttgcattgtcttaaataccctctttatggccatggag
cactaccccatgactgagcaattcagtagtgtgttgactgtaggaaacctggtctttact
gggattttcacagcagaaatggttctcaagatcattgccatggatccttattactatttc
caagaaggctggaatatctttgatggaattattgtcagcctcagtttaatggagcttggt
ctgtcaaatgtggagggattgtctgtactgcgatcattcagactgcttagagttttcaag
ttggcaaaatcctggcccacactaaatatgctaattaagatcattggcaattctgtgggg
gctctaggaaacctcaccttggtgttggccatcatcgtcttcatttttgctgtggtcggc
atgcagctctttggtaagagctacaaagaatgtgtctgcaagatcaatgatgactgtacg
ctcccacggtggcacatgaacgacttcttccactccttcctgattgtgttccgcgtgctg
tgtggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgc
cttattgttttcatgttggtcatggtcattggaaaccttgtggttctgaacctctttctg
gccttattgttgagttcatttagctcagacaaccttgctgctactgatgatgacaatgaa
atgaataatctgcagattgcagtaggaagaatgcaaaagggaattgattatgtgaaaaat
aagatgcgggagtgtttccaaaaagccttttttagaaagccaaaagttatagaaatccat
gaaggcaataagatagacagctgcatgtccaataatactggaattgaaataagcaaagag
cttaattatcttagagatgggaatggaaccaccagtggtgtaggtactggaagcagtgtt
gaaaaatacgtaatcgatgaaaatgattatatgtcattcataaacaaccccagcctcacc
gtcacagtgccaattgctgttggagagtctgactttgaaaacttaaatactgaagagttc
agcagtgagtcagaactagaagaaagcaaagagaaattaaatgcaaccagctcatctgaa
ggaagcacagttgatgttgttctaccccgagaaggtgaacaagctgaaactgaacccgaa
gaagaccttaaaccggaagcttgttttactgaaggatgtattaaaaagtttccattctgt
caagtaagtacagaagaaggcaaagggaagatctggtggaatcttcgaaaaacctgctac
agtattgttgagcacaactggtttgagactttcattgtgttcatgatccttctcagtagt
ggtgcattggcctttgaagatatatacattgaacagcgaaagactatcaaaaccatgcta
gaatatgctgacaaagtctttacctatatattcattctggaaatgcttctcaaatgggtt
gcttatggatttcaaacatatttcactaatgcctggtgctggctagatttcttgatcgtt
gatgtttctttggttagcctggtagccaatgctcttggctactcagaactcggtgccatc
aaatcattacggacattaagagctttaagacctctaagagccttatcccggtttgaaggc
atgagggtggttgtgaatgctcttgttggagcaattccctctatcatgaatgtgctgttg
gtctgtctcatcttctggttgatctttagcatcatgggtgtgaatttgtttgctggcaag
ttctaccactgtgttaacatgacaacgggtaacatgtttgacattagtgatgttaacaat
ttgagtgactgtcaggctcttggcaagcaagctcggtggaaaaacgtgaaagtaaacttt
gataatgttggcgctggctatcttgcactgcttcaagtggccacatttaaaggctggatg
gatattatgtatgcagctgttgattcacgagatgttaaacttcagcctgtatatgaagaa
aatctgtacatgtatttatactttgtcatctttatcatctttgggtcattcttcactctg
aatctattcattggtgtcatcatagataacttcaaccagcagaaaaagaagtttggaggt
caagacatctttatgacagaggaacagaaaaaatattacaatgcaatgaagaaacttgga
tccaagaaacctcagaaacccatacctcgcccagcaaacaaattccaaggaatggtcttt
gattttgtaaccagacaagtctttgatatcagcatcatgatcctcatctgcctcaacatg
gtcaccatgatggtggaaacggatgaccagggcaaatacatgaccctagttttgtcccgg
atcaacctagtgttcattgttctgttcactggagaatttgtgctgaagctcgtctccctc
agacactactacttcactataggctggaacatctttgactttgtggtggtgattctctcc
attgtaggtatgtttctggctgagatgatagaaaagtattttgtgtcccctaccttgttc
cgagtgatccgtcttgccaggattggccgaatcctacgtctgatcaaaggagcaaagggg
atccgcacgctgctctttgctttgatgatgtcccttcctgcgttgtttaacatcggcctc
ctgctcttcctggtcatgtttatctatgccatctttgggatgtccaactttgcctatgtt
aaaaaggaagctggaattgatgacatgttcaactttgagacctttggcaacagcatgatc
tgcttgttccaaattacaacctctgctggctgggatggattgctagcacctattcttaat
agtgcaccacccgactgtgaccctgacacaattcaccctggcagctcagttaagggagac
tgtgggaacccatctgttgggattttcttttttgtcagttacatcatcatatccttcctg
gttgtggtgaacatgtacatcgcggtcatcctggagaacttcagtgttgctactgaagaa
agtgcagagcccctgagtgaggatgactttgagatgttctatgaggtttgggaaaagttt
gatcccgatgcgacccagtttatagagttctctaaactctctgattttgcagctgccctg
gatcctcctcttctcatagcaaaacccaacaaagtccagcttattgccatggatctgccc
atggtcagtggtgaccggatccactgtcttgatattttatttgcctttacaaagcgtgtt
ttgggtgagagtggagagatggatgcccttcgaatacagatggaagacaggtttatggca
tcaaacccctccaaagtctcttatgagcctattacaaccactttgaaacgtaaacaagag
gaggtgtctgccgctatcattcagcgtaatttcagatgttatcttttaaagcaaaggtta
aaaaatatatcaagtaactataacaaagaggcaattaaagggaggattgacttacctata
aaacaagacatgattattgacaaactaaatgggaactccactccagaaaaaacagatggg
agttcctctaccacctctcctccttcctatgatagtgtaacaaaaccagacaaggaaaag
tttgagaaagacaaaccagaaaaagaaagcaaaggaaaagaggtcagagaaaatcaaaag
taa

DBGET integrated database retrieval system