KEGG   Homo sapiens (human): 6330Help
Entry
6330              CDS       T01001                                 

Gene name
SCN4B, ATFB17, LQT10, Navbeta4
Definition
(RefSeq) sodium voltage-gated channel beta subunit 4
  KO
K04848  
voltage-gated sodium channel type IV beta
Organism
hsa  Homo sapiens (human)
Pathway
Adrenergic signaling in cardiomyocytes
Disease
H00720  
Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6330 (SCN4B)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN beta
   6330 (SCN4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 228 aa AA seqDB search
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcccggggctggggacggaggcaaagccccggcgagatggctgggcactgggcttttg
ggcctcttcctgctccccgtaaccctgtcgctggaggtgtctgtgggaaaggccaccgac
atctacgctgtcaatggcacggagatcctgctgccctgcaccttctccagctgctttggc
ttcgaggacctccacttccggtggacctacaacagcagtgacgcattcaagattctcata
gaggggactgtgaagaatgagaagtctgaccccaaggtgacgttgaaagacgatgaccgc
atcactctggtaggctctactaaggagaagatgaacaacatttccattgtgctgagggac
ctggagttcagcgacacgggcaaatacacctgccatgtgaagaaccccaaggagaataat
ctccagcaccacgccaccatcttcctccaagtcgttgatagactggaagaagtggacaac
acagtgacactcatcatcctggctgtcgtgggcggggtcatcgggctcctcatcctcatc
ctgctgatcaagaaactcatcatcttcatcctgaagaagactcgggagaagaagaaggag
tgtctcgtgagctcctcggggaatgacaacacggagaacggcttgcctggctccaaggca
gaggagaaaccaccttcaaaagtgtga

DBGET integrated database retrieval system