KEGG   Homo sapiens (human): 6334Help
Entry
6334              CDS       T01001                                 

Gene name
SCN8A, CERIII, CIAT, EIEE13, MED, NaCh6, Nav1.6, PN4
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 8
  KO
K04840  
voltage-gated sodium channel type VIII alpha
Organism
hsa  Homo sapiens (human)
Drug target
Quinidine [DG:DG00192]: 
Procainamide [DG:DG00193]: 
Disopyramide [DG:DG00194]: 
Ajmaline: 
Lidocaine [DG:DG00196]: 
Mexiletine [DG:DG00197]: 
Tocainide [DG:DG00198]: 
Aprindine [DG:DG00199]: 
Propafenone [DG:DG00200]: 
Flecainide [DG:DG00201]: 
Encainide [DG:DG00203]: 
Bunaftine: 
Moracizine [DG:DG00208]: 
Cibenzoline [DG:DG00209]: 
Tetracaine [DG:DG00296]: 
Benzocaine: 
Cinchocaine [DG:DG00297]: 
Procaine [DG:DG00298]: 
Aminobenzoic acid [DG:DG00379]: 
Chloroprocaine [DG:DG00800]: 
Bupivacaine [DG:DG00801]: 
Mepivacaine [DG:DG00802]: 
Ropivacaine [DG:DG00806]: 
Levobupivacaine [DG:DG00807]: 
Dyclonine [DG:DG00809]: 
Phenytoin [DG:DG00846]: 
Mephenytoin: 
Fosphenytoin [DG:DG00847]: 
Carbamazepine: 
Oxcarbazepine: 
Eslicarbazepine [DG:DG00848]: 
Lamotrigine: 
Topiramate: 
Zonisamide: 
Ambroxol [DG:DG01073]: 
Proxymetacaine [DG:DG01145]: 
Other: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6334 (SCN8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 1980 aa AA seqDB search
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNL
IRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIAR
GFCIDGFTFLRDPWNWLDFSVIMMAYITEFVNLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGF
DWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAF
LALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEI
SKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKF
SIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDS
LFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGSHIG
GRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCP
PCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQ
FEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGL
SVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKS
YKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMV
MVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQ
AHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIID
EDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIK
PEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWF
ETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFF
TNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNAL
VGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTECEKLM
EGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYM
YIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKP
QKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLV
FVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIR
LARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEA
GIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPS
VGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDAT
QFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSG
ELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKT
TSNKLENGGTHREKKESTPSTASLPSYDSVTKPEKEKQQRAEEGRRERAKRQKEVRESKC
NT seq 5943 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcggctgcttgcaccaccaggccctgatagtttcaagcctttcacccctgag
tcactggcaaacattgagaggcgcattgctgagagcaagctcaagaaaccaccaaaggcc
gatggcagtcatcgggaggacgatgaggacagcaagcccaagccaaacagcgacctggaa
gcagggaagagtttgcctttcatctacggggacatcccccaaggcctggttgcagttccc
ctggaggactttgacccatactatttgacgcagaaaacctttgtagtattaaacagaggg
aaaactctcttcagatttagtgccacgcctgccttgtacattttaagtccttttaacctg
ataagaagaatagctattaaaattttgatacattcagtatttagcatgatcattatgtgc
actattttgaccaactgtgtattcatgacttttagtaaccctcctgactggtcgaagaat
gtggagtacacgttcacagggatttatacatttgaatcactagtgaaaatcattgcaaga
ggtttctgcatagatggctttacctttttacgggacccatggaactggttagatttcagt
gtcatcatgatggcgtatataacagagtttgtaaacctaggcaatgtttcagctctacgc
actttcagggtactgagggctttgaaaactatttcggtaatcccaggcctgaagacaatt
gtgggtgccctgattcagtctgtgaagaaactgtcagatgtgatgatcctgacagtgttc
tgcctgagtgtttttgccttgatcggactgcagctgttcatggggaaccttcgaaacaag
tgtgttgtgtggcccataaacttcaacgagagctatcttgaaaatggcaccaaaggcttt
gattgggaagagtatatcaacaataaaacaaatttctacacagttcctggcatgctggaa
cctttactctgtgggaacagttctgatgctgggcaatgcccagagggataccagtgtatg
aaagcaggaaggaaccccaactatggttacacaagttttgacacttttagctgggccttc
ttggcattatttcgccttatgacccaggactattgggaaaacttgtatcaattgacttta
cgagcagccgggaaaacatacatgatcttcttcgtcttggtcatctttgtgggttctttc
tatctggtgaacttgatcttggctgtggtggccatggcttatgaagaacagaatcaggca
acactggaggaggcagaacaaaaagaggctgaatttaaagcaatgttggagcaacttaag
aagcaacaggaagaggcacaggctgctgcgatggccacttcagcaggaactgtctcagaa
gatgccatagaggaagaaggtgaagaaggagggggctcccctcggagctcttctgaaatc
tctaaactcagctcaaagagtgcaaaggaaagacgtaacaggagaaagaagaggaagcaa
aaggaactctctgaaggagaggagaaaggggatcccgagaaggtgtttaagtcagagtca
gaagatggcatgagaaggaaggcctttcggctgccagacaacagaatagggaggaaattt
tccatcatgaatcagtcactgctcagcatcccaggctcgcccttcctctcccgccacaac
agcaagagcagcatcttcagtttcaggggacctgggcggttccgagacccgggctccgag
aatgagttcgcggatgacgagcacagcacggtggaggagagcgagggccgccgggactcc
ctcttcatccccatccgggcccgcgagcgccggagcagctacagcggctacagcggctac
agccagggcagccgctcctcgcgcatcttccccagcctgcggcgcagcgtgaagcgcaac
agcacggtggactgcaacggcgtggtgtccctcatcggcggccccggctcccacatcggc
gggcgtctcctgccagaggctacaactgaggtggaaattaagaagaaaggccctggatct
cttttagtttccatggaccaattagcctcctacgggcggaaggacagaatcaacagtata
atgagtgttgttacaaatacactagtagaagaactggaagagtctcagagaaagtgcccg
ccatgctggtataaatttgccaacactttcctcatctgggagtgccacccctactggata
aaactgaaagagattgtgaacttgatagttatggacccttttgtggatttagccatcacc
atctgcatcgtcctgaatacactgtttatggcaatggagcaccatcctatgacaccacaa
tttgaacatgtcttggctgtaggaaatctggttttcactggaattttcacagcggaaatg
ttcctgaagctcatagccatggatccctactattatttccaagaaggttggaacattttt
gacggatttattgtctccctcagtttaatggaactgagtctagcagacgtggaggggctt
tcagtgctgcgatctttccgattgctccgagtcttcaaattggccaaatcctggcccacc
ctgaacatgctaatcaagattattggaaattcagtgggtgccctgggcaacctgacactg
gtgctggccattattgtcttcatctttgccgtggtggggatgcaactctttggaaaaagc
tacaaagagtgtgtctgcaagatcaaccaggactgtgaactccctcgctggcatatgcat
gactttttccattccttcctcattgtctttcgagtgttgtgcggggagtggattgagacc
atgtgggactgcatggaagtggcaggccaggccatgtgcctcattgtctttatgatggtc
atggtgattggcaacttggtggtgctgaacctgtttctggccttgctcctgagctccttc
agtgcagacaacctggctgccacagatgacgatggggaaatgaacaacctccagatctca
gtgatccgtatcaagaagggtgtggcctggaccaaactaaaggtgcacgccttcatgcag
gcccactttaagcagcgtgaggctgatgaggtgaagcctctggatgagttgtatgaaaag
aaggccaactgtatcgccaatcacaccggtgcagacatccaccggaatggtgacttccag
aagaatggcaatggcacaaccagcggcattggcagcagcgtggagaagtacatcattgat
gaggaccacatgtccttcatcaacaaccccaacttgactgtacgggtacccattgctgtg
ggcgagtctgactttgagaacctcaacacagaggatgttagcagcgagtcggatcctgaa
ggcagcaaagataaactagatgacaccagctcctctgaaggaagcaccattgatatcaaa
ccagaagtagaagaggtccctgtggaacagcctgaggaatacttggatccagatgcctgc
ttcacagaaggttgtgtccagcggttcaagtgctgccaggtcaacatcgaggaagggcta
ggcaagtcttggtggatcctgcggaaaacctgcttcctcatcgtggagcacaactggttt
gagaccttcatcatcttcatgattctgctgagcagtggcgccctggccttcgaggacatc
tacattgagcagagaaagaccatccgcaccatcctggaatatgctgacaaagtcttcacc
tatatcttcatcctggagatgttgctcaagtggacagcctatggcttcgtcaagttcttc
accaatgcctggtgttggctggacttcctcattgtggctgtctctttagtcagccttata
gctaatgccctgggctactcggaactaggtgccataaagtcccttaggaccctaagagct
ttgagacccttaagagccttatcacgatttgaagggatgagggtggtggtgaatgccttg
gtgggcgccatcccctccatcatgaatgtgctgctggtgtgtctcatcttctggctgatt
ttcagcatcatgggagttaacttgtttgcgggaaagtaccactactgctttaatgagact
tctgaaatccgatttgaaattgaagatgtcaacaataaaactgaatgtgaaaagcttatg
gaggggaacaatacagagatcagatggaagaacgtgaagatcaactttgacaatgttggg
gcaggatacctggcccttcttcaagtagcaaccttcaaaggctggatggacatcatgtat
gcagctgtagattcccggaagcctgatgagcagcctaagtatgaggacaatatctacatg
tacatctattttgtcatcttcatcatcttcggctccttcttcaccctgaacctgttcatt
ggtgtcatcattgataacttcaatcaacaaaagaaaaagttcggaggtcaggacatcttc
atgaccgaagaacagaagaagtactacaatgccatgaaaaagctgggctcaaagaagcca
cagaaacctattccccgccccttgaacaaaatccaaggaatcgtctttgattttgtcact
cagcaagcctttgacattgttatcatgatgctcatctgccttaacatggtgacaatgatg
gtggagacagacactcaaagcaagcagatggagaacatcctctactggattaacctggtg
tttgttatcttcttcacctgtgagtgtgtgctcaaaatgtttgcgttgaggcactactac
ttcaccattggctggaacatcttcgacttcgtggtagtcatcctctccattgtgggaatg
ttcctggcagatataattgagaaatactttgtttccccaaccctattccgagtcatccga
ttggcccgtattgggcgcatcttgcgtctgatcaaaggcgccaaagggattcgtaccctg
ctctttgccttaatgatgtccttgcctgccctgttcaacatcggccttctgctcttcctg
gtcatgttcatcttctccatttttgggatgtccaattttgcatatgtgaagcacgaggct
ggtatcgatgacatgttcaactttgagacatttggcaacagcatgatctgcctgtttcaa
atcacaacctcagctggttgggatggcctgctgctgcccatcctaaaccgcccccctgac
tgcagcctagataaggaacacccagggagtggctttaagggagattgtgggaacccctca
gtgggcatcttcttctttgtaagctacatcatcatctctttcctaattgtcgtgaacatg
tacattgccatcatcctggagaacttcagtgtagccacagaggaaagtgcagaccctctg
agtgaggatgactttgagaccttctatgagatctgggagaagttcgaccccgatgccacc
cagttcattgagtactgtaagctggcagactttgcagatgccttggagcatcctctccga
gtgcccaagcccaataccattgagctcatcgctatggatctgccaatggtgagcggggat
cgcatccactgcttggacatcctttttgccttcaccaagcgggtcctgggagatagcggg
gagttggacatcctgcggcagcagatggaagagcggttcgtggcatccaatccttccaaa
gtgtcttacgagccaatcacaaccacactgcgtcgcaagcaggaggaggtatctgcagtg
gtcctgcagcgtgcctaccggggacatttggcaaggcggggcttcatctgcaaaaagaca
acttctaataagctggagaatggaggcacacaccgggagaaaaaagagagcaccccatct
acagcctccctcccgtcctatgacagtgtaactaaacctgaaaaggagaaacagcagcgg
gcagaggaaggaagaagggaaagagccaaaagacaaaaagaggtcagagaatccaagtgt
tag

DBGET integrated database retrieval system