KEGG   Homo sapiens (human): 6334Help
Entry
6334              CDS       T01001                                 

Gene name
SCN8A, BFIS5, CERIII, CIAT, EIEE13, MED, NaCh6, Nav1.6, PN4
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 8
  KO
K04840  
voltage-gated sodium channel type VIII alpha
Organism
hsa  Homo sapiens (human)
Drug target
Ajmaline: 
Ambroxol (DG01073): 
Aminobenzoic acid (DG00379): 
Aprindine (DG00199): 
Articaine (DG00805): 
Benzocaine: 
Bunaftine: 
Bupivacaine (DG00801): 
Carbamazepine: 
Chloroprocaine (DG00800): 
Cibenzoline (DG00209): 
Cinchocaine (DG00297): 
Cocaine (DG00808): 
Disopyramide (DG00194): 
Dyclonine (DG00809): 
Encainide (DG00203): 
Eslicarbazepine (DG00848): 
Etidocaine (DG00804): 
Flecainide (DG00201): 
Fosphenytoin (DG00847): 
Hydroquinidine (DG01791): 
Lamotrigine: 
Levobupivacaine (DG00807): 
Lidocaine (DG00196): 
Mephenytoin: 
Mepivacaine (DG00802): 
Mexiletine (DG00197): 
Moracizine (DG00208): 
Oxcarbazepine: 
Phenytoin (DG00846): 
Pilsicainide (DG01257): 
Pirmenol (DG01381): 
Prilocaine (DG00803): 
Procainamide (DG00193): 
Procaine (DG00298): 
Propafenone (DG00200): 
Proxymetacaine (DG01145): 
Quinidine (DG00192): 
Ropivacaine (DG00806): 
Tetracaine (DG00296): 
Tocainide (DG00198): 
Topiramate: 
Zonisamide: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6334 (SCN8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 1980 aa AA seqDB search
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLE
AGKSLPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNL
IRRIAIKILIHSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIAR
GFCIDGFTFLRDPWNWLDFSVIMMAYITEFVNLGNVSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGF
DWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAF
LALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEI
SKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKF
SIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDS
LFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGSHIG
GRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCP
PCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQ
FEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGL
SVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKS
YKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMV
MVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQ
AHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIID
EDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIK
PEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWF
ETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFF
TNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNAL
VGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTECEKLM
EGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYM
YIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKP
QKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLV
FVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIR
LARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEA
GIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPS
VGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDAT
QFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSG
ELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKT
TSNKLENGGTHREKKESTPSTASLPSYDSVTKPEKEKQQRAEEGRRERAKRQKEVRESKC
NT seq 5943 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcggctgcttgcaccaccaggccctgatagtttcaagcctttcacccctgag
tcactggcaaacattgagaggcgcattgctgagagcaagctcaagaaaccaccaaaggcc
gatggcagtcatcgggaggacgatgaggacagcaagcccaagccaaacagcgacctggaa
gcagggaagagtttgcctttcatctacggggacatcccccaaggcctggttgcagttccc
ctggaggactttgacccatactatttgacgcagaaaacctttgtagtattaaacagaggg
aaaactctcttcagatttagtgccacgcctgccttgtacattttaagtccttttaacctg
ataagaagaatagctattaaaattttgatacattcagtatttagcatgatcattatgtgc
actattttgaccaactgtgtattcatgacttttagtaaccctcctgactggtcgaagaat
gtggagtacacgttcacagggatttatacatttgaatcactagtgaaaatcattgcaaga
ggtttctgcatagatggctttacctttttacgggacccatggaactggttagatttcagt
gtcatcatgatggcgtatataacagagtttgtaaacctaggcaatgtttcagctctacgc
actttcagggtactgagggctttgaaaactatttcggtaatcccaggcctgaagacaatt
gtgggtgccctgattcagtctgtgaagaaactgtcagatgtgatgatcctgacagtgttc
tgcctgagtgtttttgccttgatcggactgcagctgttcatggggaaccttcgaaacaag
tgtgttgtgtggcccataaacttcaacgagagctatcttgaaaatggcaccaaaggcttt
gattgggaagagtatatcaacaataaaacaaatttctacacagttcctggcatgctggaa
cctttactctgtgggaacagttctgatgctgggcaatgcccagagggataccagtgtatg
aaagcaggaaggaaccccaactatggttacacaagttttgacacttttagctgggccttc
ttggcattatttcgccttatgacccaggactattgggaaaacttgtatcaattgacttta
cgagcagccgggaaaacatacatgatcttcttcgtcttggtcatctttgtgggttctttc
tatctggtgaacttgatcttggctgtggtggccatggcttatgaagaacagaatcaggca
acactggaggaggcagaacaaaaagaggctgaatttaaagcaatgttggagcaacttaag
aagcaacaggaagaggcacaggctgctgcgatggccacttcagcaggaactgtctcagaa
gatgccatagaggaagaaggtgaagaaggagggggctcccctcggagctcttctgaaatc
tctaaactcagctcaaagagtgcaaaggaaagacgtaacaggagaaagaagaggaagcaa
aaggaactctctgaaggagaggagaaaggggatcccgagaaggtgtttaagtcagagtca
gaagatggcatgagaaggaaggcctttcggctgccagacaacagaatagggaggaaattt
tccatcatgaatcagtcactgctcagcatcccaggctcgcccttcctctcccgccacaac
agcaagagcagcatcttcagtttcaggggacctgggcggttccgagacccgggctccgag
aatgagttcgcggatgacgagcacagcacggtggaggagagcgagggccgccgggactcc
ctcttcatccccatccgggcccgcgagcgccggagcagctacagcggctacagcggctac
agccagggcagccgctcctcgcgcatcttccccagcctgcggcgcagcgtgaagcgcaac
agcacggtggactgcaacggcgtggtgtccctcatcggcggccccggctcccacatcggc
gggcgtctcctgccagaggctacaactgaggtggaaattaagaagaaaggccctggatct
cttttagtttccatggaccaattagcctcctacgggcggaaggacagaatcaacagtata
atgagtgttgttacaaatacactagtagaagaactggaagagtctcagagaaagtgcccg
ccatgctggtataaatttgccaacactttcctcatctgggagtgccacccctactggata
aaactgaaagagattgtgaacttgatagttatggacccttttgtggatttagccatcacc
atctgcatcgtcctgaatacactgtttatggcaatggagcaccatcctatgacaccacaa
tttgaacatgtcttggctgtaggaaatctggttttcactggaattttcacagcggaaatg
ttcctgaagctcatagccatggatccctactattatttccaagaaggttggaacattttt
gacggatttattgtctccctcagtttaatggaactgagtctagcagacgtggaggggctt
tcagtgctgcgatctttccgattgctccgagtcttcaaattggccaaatcctggcccacc
ctgaacatgctaatcaagattattggaaattcagtgggtgccctgggcaacctgacactg
gtgctggccattattgtcttcatctttgccgtggtggggatgcaactctttggaaaaagc
tacaaagagtgtgtctgcaagatcaaccaggactgtgaactccctcgctggcatatgcat
gactttttccattccttcctcattgtctttcgagtgttgtgcggggagtggattgagacc
atgtgggactgcatggaagtggcaggccaggccatgtgcctcattgtctttatgatggtc
atggtgattggcaacttggtggtgctgaacctgtttctggccttgctcctgagctccttc
agtgcagacaacctggctgccacagatgacgatggggaaatgaacaacctccagatctca
gtgatccgtatcaagaagggtgtggcctggaccaaactaaaggtgcacgccttcatgcag
gcccactttaagcagcgtgaggctgatgaggtgaagcctctggatgagttgtatgaaaag
aaggccaactgtatcgccaatcacaccggtgcagacatccaccggaatggtgacttccag
aagaatggcaatggcacaaccagcggcattggcagcagcgtggagaagtacatcattgat
gaggaccacatgtccttcatcaacaaccccaacttgactgtacgggtacccattgctgtg
ggcgagtctgactttgagaacctcaacacagaggatgttagcagcgagtcggatcctgaa
ggcagcaaagataaactagatgacaccagctcctctgaaggaagcaccattgatatcaaa
ccagaagtagaagaggtccctgtggaacagcctgaggaatacttggatccagatgcctgc
ttcacagaaggttgtgtccagcggttcaagtgctgccaggtcaacatcgaggaagggcta
ggcaagtcttggtggatcctgcggaaaacctgcttcctcatcgtggagcacaactggttt
gagaccttcatcatcttcatgattctgctgagcagtggcgccctggccttcgaggacatc
tacattgagcagagaaagaccatccgcaccatcctggaatatgctgacaaagtcttcacc
tatatcttcatcctggagatgttgctcaagtggacagcctatggcttcgtcaagttcttc
accaatgcctggtgttggctggacttcctcattgtggctgtctctttagtcagccttata
gctaatgccctgggctactcggaactaggtgccataaagtcccttaggaccctaagagct
ttgagacccttaagagccttatcacgatttgaagggatgagggtggtggtgaatgccttg
gtgggcgccatcccctccatcatgaatgtgctgctggtgtgtctcatcttctggctgatt
ttcagcatcatgggagttaacttgtttgcgggaaagtaccactactgctttaatgagact
tctgaaatccgatttgaaattgaagatgtcaacaataaaactgaatgtgaaaagcttatg
gaggggaacaatacagagatcagatggaagaacgtgaagatcaactttgacaatgttggg
gcaggatacctggcccttcttcaagtagcaaccttcaaaggctggatggacatcatgtat
gcagctgtagattcccggaagcctgatgagcagcctaagtatgaggacaatatctacatg
tacatctattttgtcatcttcatcatcttcggctccttcttcaccctgaacctgttcatt
ggtgtcatcattgataacttcaatcaacaaaagaaaaagttcggaggtcaggacatcttc
atgaccgaagaacagaagaagtactacaatgccatgaaaaagctgggctcaaagaagcca
cagaaacctattccccgccccttgaacaaaatccaaggaatcgtctttgattttgtcact
cagcaagcctttgacattgttatcatgatgctcatctgccttaacatggtgacaatgatg
gtggagacagacactcaaagcaagcagatggagaacatcctctactggattaacctggtg
tttgttatcttcttcacctgtgagtgtgtgctcaaaatgtttgcgttgaggcactactac
ttcaccattggctggaacatcttcgacttcgtggtagtcatcctctccattgtgggaatg
ttcctggcagatataattgagaaatactttgtttccccaaccctattccgagtcatccga
ttggcccgtattgggcgcatcttgcgtctgatcaaaggcgccaaagggattcgtaccctg
ctctttgccttaatgatgtccttgcctgccctgttcaacatcggccttctgctcttcctg
gtcatgttcatcttctccatttttgggatgtccaattttgcatatgtgaagcacgaggct
ggtatcgatgacatgttcaactttgagacatttggcaacagcatgatctgcctgtttcaa
atcacaacctcagctggttgggatggcctgctgctgcccatcctaaaccgcccccctgac
tgcagcctagataaggaacacccagggagtggctttaagggagattgtgggaacccctca
gtgggcatcttcttctttgtaagctacatcatcatctctttcctaattgtcgtgaacatg
tacattgccatcatcctggagaacttcagtgtagccacagaggaaagtgcagaccctctg
agtgaggatgactttgagaccttctatgagatctgggagaagttcgaccccgatgccacc
cagttcattgagtactgtaagctggcagactttgcagatgccttggagcatcctctccga
gtgcccaagcccaataccattgagctcatcgctatggatctgccaatggtgagcggggat
cgcatccactgcttggacatcctttttgccttcaccaagcgggtcctgggagatagcggg
gagttggacatcctgcggcagcagatggaagagcggttcgtggcatccaatccttccaaa
gtgtcttacgagccaatcacaaccacactgcgtcgcaagcaggaggaggtatctgcagtg
gtcctgcagcgtgcctaccggggacatttggcaaggcggggcttcatctgcaaaaagaca
acttctaataagctggagaatggaggcacacaccgggagaaaaaagagagcaccccatct
acagcctccctcccgtcctatgacagtgtaactaaacctgaaaaggagaaacagcagcgg
gcagaggaaggaagaagggaaagagccaaaagacaaaaagaggtcagagaatccaagtgt
tag

DBGET integrated database retrieval system