KEGG   Homo sapiens (human): 6336Help
Entry
6336              CDS       T01001                                 

Gene name
SCN10A, FEPS2, Nav1.8, PN3, SNS, hPN3
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 10
  KO
K04842  voltage-gated sodium channel type X alpha
Organism
hsa  Homo sapiens (human)
Disease
H01391  Familial episodic pain syndrome (FEPS)
Drug target
Ajmaline: D00199
Aminobenzoic acid (DG00379): D02456 D02906 D02907
Amiodarone (DG00204): D00636 D02910
Aprindine (DG00199): D01326 D02969
Articaine (DG00805): D02991 D07468
Benzocaine: D00552
Bupivacaine (DG00801): D01450 D07552
Carbamazepine: D00252
Chloroprocaine (DG00800): D00732 D07678
Cibenzoline (DG00209): D01455 D03492
Cinchocaine (DG00297): D00733 D02220
Cocaine (DG00808): D00110 D02182
Disopyramide (DG00194): D00303 D00637
Encainide (DG00203): D03991 D07894
Eslicarbazepine (DG00848): D09215 D09612
Ethyl piperidinoacetylaminobenzoate: D01519
Etidocaine (DG00804): D00737 D04095
Flecainide (DG00201): D00638 D07962
Fosphenytoin (DG00847): D02096 D07595 D07993
Lacosamide: D07299
Lamotrigine: D00354
Levobupivacaine (DG00807): D01287 D08116
Lidocaine (DG00196): D00358 D02086 D08127
Lorajmine: D04774
Mephenytoin: D00375
Mepivacaine (DG00802): D00738 D08181
Mexiletine (DG00197): D00639 D08215
Oxcarbazepine: D00533
Oxetacaine (DG00299): D01152 D08311
Oxybuprocaine (DG00392): D01768 D08319
Phenytoin (DG00846): D00512 D02103
Pilsicainide (DG01257): D01554 D08377
Pirmenol (DG01381): D01785 D06517 D08394
Pramocaine (DG00300): D00739 D08407
Prilocaine (DG00803): D00553 D01243
Procainamide (DG00193): D00477 D08421
Procaine (DG00298): D00740 D08422
Propafenone (DG00200): D00640 D08435
Proxymetacaine (DG01145): D02098 D08448
Quinidine (DG00192): D00642 D00643 D02272 D08458 D08459
Ropivacaine (DG00806): D04048 D08490
Rufinamide: D05775
Sparteine (DG00195): D01041 D02239
Tetracaine (DG00296): D00551 D00741
Tocainide (DG00198): D02088 D06172
Topiramate: D00537
Zonisamide: D00538
p-Butylaminobenzoyldiethylaminoethyl hydrochloride: D01967
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6336 (SCN10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_assoc PKD_channel GPHH Na_trans_cytopl
Motif
Other DBs
NCBI-GeneID: 6336
NCBI-ProteinID: NP_006505
OMIM: 604427
HGNC: 10582
Ensembl: ENSG00000185313
Vega: OTTHUMG00000048245
Pharos: Q9Y5Y9(Tclin)
UniProt: Q9Y5Y9
Position
3p22.2
AA seq 1956 aa AA seqDB search
MEFPIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN
KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRTSGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE
ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPRSD
PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLG
GGAGQQGPLPRSPLPQPSNPDSRHGEDEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAEY
LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG
LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD
PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII
GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL
IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA
PEDDGEVNNLQVALARIQVFGHRTKQALCSFFSRSCPFPQPKAEPELVVKLPLSSSKAEN
HIAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSF
QQEVIPKGQQEQLQQVERCGDHLTPRSPGTGTSSEDLAPSLGETWKDESVPQVPAEGVDD
TSSSEGSTVDCLDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKLDTTKSPWDVGWQ
VRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVFE
MLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLRA
LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSL
VPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR
EVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK
KYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDDQ
SEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAIL
KSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI
YSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDP
NLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSEDD
FDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIHC
LDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQK
AYRSYVLHRSMALSNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPS
YESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP
NT seq 5871 nt NT seq  +upstreamnt  +downstreamnt
atggaattccccattggatccctcgaaactaacaacttccgtcgctttactccggagtca
ctggtggagatagagaagcaaattgctgccaagcagggaacaaagaaagccagagagaag
catagggagcagaaggaccaagaagagaagcctcggccccagctggacttgaaagcctgc
aaccagctgcccaagttctatggtgagctcccagcagaactgatcggggagcccctggag
gatctagatccgttctacagcacacaccggacatttatggtgctgaacaaagggaggacc
atttcccggtttagtgccactcgggccctgtggctattcagtcctttcaacctgatcaga
agaacggccatcaaagtgtctgtccactcgtggttcagtttatttattacggtcactatt
ttggttaattgtgtgtgcatgacccgaactgaccttccagagaaaattgaatatgtcttc
actgtcatttacacctttgaagccttgataaagatactggcaagaggattttgtctaaat
gagttcacgtacctgagagatccttggaactggctggattttagcgtcattaccctggca
tatgttggcacagcaatagatctccgtgggatctcaggcctgcggacattcagagttctt
agagcattaaaaacagtttctgtgatcccaggcctgaaggtcattgtgggggccctgatt
cactcagtgaagaaactggctgatgtgaccatcctcaccatcttctgcctaagtgttttt
gccttggtggggctgcaactcttcaagggcaacctcaaaaataaatgtgtcaagaatgac
atggctgtcaatgagacaaccaactactcatctcacagaaaaccagatatctacataaat
aagcgaggcacttctgaccccttactgtgtggcaatggatctgactcaggccactgccct
gatggttatatctgccttaaaacttctgacaacccggattttaactacaccagctttgat
tcctttgcttgggctttcctctcactgttccgcctcatgacacaggattcctgggaacgc
ctctaccagcagaccctgaggacttctgggaaaatctatatgatcttttttgtgctcgta
atcttcctgggatctttctacctggtcaacttgatcttggctgtagtcaccatggcgtat
gaggagcagaaccaggcaaccactgatgaaattgaagcaaaggagaagaagttccaggag
gccctcgagatgctccggaaggagcaggaggtgctagcagcactagggattgacacaacc
tctctccactcccacaatggatcacctttaacctccaaaaatgccagtgagagaaggcat
agaataaagccaagagtgtcagagggctccacagaagacaacaaatcaccccgctctgat
ccttacaaccagcgcaggatgtcttttctaggcctcgcctctggaaaacgccgggctagt
catggcagtgtgttccatttccggtcccctggccgagatatctcactccctgagggagtc
acagatgatggagtctttcctggagaccacgaaagccatcggggctctctgctgctgggt
gggggtgctggccagcaaggccccctccctagaagccctcttcctcaacccagcaaccct
gactccaggcatggagaagatgaacaccaaccgccgcccactagtgagcttgcccctgga
gctgtcgatgtctcggcattcgatgcaggacaaaagaagactttcttgtcagcagaatac
ttagatgaacctttccgggcccaaagggcaatgagtgttgtcagtatcataacctccgtc
cttgaggaactcgaggagtctgaacagaagtgcccaccctgcttgaccagcttgtctcag
aagtatctgatctgggattgctgccccatgtgggtgaagctcaagacaattctctttggg
cttgtgacggatccctttgcagagctcaccatcaccttgtgcatcgtggtgaacaccatc
ttcatggccatggagcaccatggcatgagccctaccttcgaagccatgctccagataggc
aacatcgtctttaccatattttttactgctgaaatggtcttcaaaatcattgccttcgac
ccatactattatttccagaagaagtggaatatctttgactgcatcatcgtcactgtgagt
ctgctagagctgggcgtggccaagaagggaagcctgtctgtgctgcggagcttccgcttg
ctgcgcgtattcaagctggccaaatcctggcccaccttaaacacactcatcaagatcatc
ggaaactcagtgggggcactggggaacctcaccatcatcctggccatcattgtctttgtc
tttgctctggttggcaagcagctcctaggggaaaactaccgtaacaaccgaaaaaatatc
tccgcgccccatgaagactggccccgctggcacatgcacgacttcttccactctttcctc
attgtcttccgtatcctctgtggagagtggattgagaacatgtgggcctgcatggaagtt
ggccaaaaatccatatgcctcatccttttcttgacggtgatggtgctagggaacctggtg
gtgcttaacctgttcatcgccctgctattgaactctttcagtgctgacaacctcacagcc
ccggaggacgatggggaggtgaacaacctgcaggtggccctggcacggatccaggtcttt
ggccatcgtaccaaacaggctctttgcagcttcttcagcaggtcctgcccattcccccag
cccaaggcagagcctgagctggtggtgaaactcccactctccagctccaaggctgagaac
cacattgctgccaacactgccagggggagctctggagggctccaagctcccagaggcccc
agggatgagcacagtgacttcatcgctaatccgactgtgtgggtctctgtgcccattgct
gagggtgaatctgatcttgatgacttggaggatgatggtggggaagatgctcagagcttc
cagcaggaagtgatccccaaaggacagcaggagcagctgcagcaagtcgagaggtgtggg
gaccacctgacacccaggagcccaggcactggaacatcttctgaggacctggctccatcc
ctgggtgagacgtggaaagatgagtctgttcctcaggtccctgctgagggagtggacgac
acaagctcctctgagggcagcacggtggactgcctagatcctgaggaaatcctgaggaag
atccctgagctggcagatgacctggaagaaccagatgactgcttcacagaaggatgcatt
cgccactgtccctgctgcaaactggataccaccaagagtccatgggatgtgggctggcag
gtgcgcaagacttgctaccgtatcgtggagcacagctggtttgagagcttcatcatcttc
atgatcctgctcagcagtggatctctggcctttgaagactattacctggaccagaagccc
acggtgaaagctttgctggagtacactgacagggtcttcacctttatctttgtgttcgag
atgctgcttaagtgggtggcctatggcttcaaaaagtacttcaccaatgcctggtgctgg
ctggacttcctcattgtgaatatctcactgataagtctcacagcgaagattctggaatat
tctgaagtggctcccatcaaagcccttcgaacccttcgcgctctgcggccactgcgggct
ctttctcgatttgaaggcatgcgggtggtggtggatgccctggtgggcgccatcccatcc
atcatgaatgtcctcctcgtctgcctcatcttctggctcatcttcagcatcatgggtgtg
aacctcttcgcagggaagttttggaggtgcatcaactataccgatggagagttttccctt
gtacctttgtcgattgtgaataacaagtctgactgcaagattcaaaactccactggcagc
ttcttctgggtcaatgtgaaagtcaactttgataatgttgcaatgggttaccttgcactt
ctgcaggtggcaacctttaaaggctggatggacattatgtatgcagctgttgattcccgg
gaggtcaacatgcaacccaagtgggaggacaacgtgtacatgtatttgtactttgtcatc
ttcatcatttttggaggcttcttcacactgaatctctttgttggggtcataattgacaac
ttcaatcaacagaaaaaaaagttagggggccaggacatcttcatgacagaggagcagaag
aaatactacaatgccatgaagaagttgggctccaagaagccccagaagcccatcccacgg
cccctgaacaagttccagggttttgtctttgacatcgtgaccagacaagcttttgacatc
accatcatggtcctcatctgcctcaacatgatcaccatgatggtggagactgatgaccaa
agtgaagaaaagacgaaaattctgggcaaaatcaaccagttctttgtggccgtcttcaca
ggcgaatgtgtcatgaagatgttcgctttgaggcagtactacttcacaaatggctggaat
gtgtttgacttcattgtggtggttctctccattgcgagcctgattttttctgcaattctt
aagtcacttcaaagttacttctccccaacgctcttcagagtcatccgcctggcccgaatt
ggccgcatcctcagactgatccgagcggccaaggggatccgcacactgctctttgccctc
atgatgtccctgcctgccctcttcaacatcgggctgttgctattccttgtcatgttcatc
tactctatcttcggtatgtccagctttccccatgtgaggtgggaggctggcatcgacgac
atgttcaacttccagaccttcgccaacagcatgctgtgcctcttccagattaccacgtcg
gccggctgggatggcctcctcagccccatcctcaacacagggcccccctactgtgacccc
aatctgcccaacagcaatggcaccagaggggactgtgggagcccagccgtaggcatcatc
ttcttcaccacctacatcatcatctccttcctcatcgtggtcaacatgtacattgcagtg
attctggagaacttcaatgtggccacggaggagagcactgagcccctgagtgaggacgac
tttgacatgttctatgagacctgggagaagtttgacccagaggccactcagtttattacc
ttttctgctctctcggactttgcagacactctctctggtcccctgagaatcccaaaaccc
aatcgaaatatactgatccagatggacctgcctttggtccctggagataagatccactgc
ttggacatcctttttgctttcaccaagaatgtcctaggagaatccggggagttggattct
ctgaaggcaaatatggaggagaagtttatggcaactaatctttcaaaatcatcctatgaa
ccaatagcaaccactctccgatggaagcaagaagacatttcagccactgtcattcaaaag
gcctatcggagctatgtgctgcaccgctccatggcactctctaacaccccatgtgtgccc
agagctgaggaggaggctgcatcactcccagatgaaggttttgttgcattcacagcaaat
gaaaattgtgtactcccagacaaatctgaaactgcttctgccacatcattcccaccgtcc
tatgagagtgtcactagaggccttagtgatagagtcaacatgaggacatctagctcaata
caaaatgaagatgaagccaccagtatggagctgattgcccctgggccctag

DBGET integrated database retrieval system