KEGG   Homo sapiens (human): 6344Help
Entry
6344              CDS       T01001                                 

Gene name
SCTR, SR
Definition
(RefSeq) secretin receptor
  KO
K04588  
secretin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Bile secretion
Drug target
Secretin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6344 (SCTR)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    6344 (SCTR)
   04976 Bile secretion
    6344 (SCTR)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Gut peptide
   Secretin
    6344 (SCTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q14.1
AA seq 440 aa AA seqDB search
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTE
QPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPN
LACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMH
LFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYL
HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAF
SPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS
NSTKASHLEQSQGTCRTSII
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccacctgtcgccgccgctgcagcagctactactgccggtgctgctcgcctgc
gccgcgcactcgactggagcccttccccgactatgtgacgtgctacaagtgctgtgggaa
gagcaagaccagtgcctgcaggaactctccagagagcagacaggagacctgggcacggag
cagccagtgccaggttgtgaggggatgtgggacaacataagctgctggccctcttctgtg
ccgggccggatggtggaggtggaatgcccgagattcctccggatgctcaccagcagaaat
ggttccttgttccgaaactgcacacaggatggctggtcagaaaccttccccaggcctaat
ctggcctgtggcgttaatgtgaacgactcttccaacgagaagcggcactcctacctgctg
aagctgaaagtcatgtacaccgtgggctacagctcctccctggtcatgctcctggtcgcc
cttggcatcctctgtgctttccggaggctccactgcactcgcaactacatccacatgcac
ctgttcgtgtccttcatccttcgtgccctgtccaacttcatcaaggacgccgtgctcttc
tcctcagatgatgtcacctactgcgatgcccacagggcgggctgcaagctggtcatggtg
ctgttccagtactgcatcatggccaactactcctggctgctggtggaaggcctctacctt
cacacactcctcgccatctccttcttctctgaaagaaagtacctccagggatttgtggca
ttcggatggggttctccagccatttttgttgctttgtgggctattgccagacactttctg
gaagatgttgggtgctgggacatcaatgccaacgcatccatctggtggatcattcgtggt
cctgtgatcctctccatcctgattaatttcatccttttcataaacattctaagaatcctg
atgagaaaacttagaacccaagaaacaagaggaaatgaagtcagccattataagcgcctg
gccaggtccactctcctgctgatccccctctttggcatccactacatcgtcttcgccttc
tccccagaggacgctatggagatccagctgttttttgaactagcccttggctcattccag
ggactggtggtggccgtcctctactgcttcctcaatggggaggtgcagctggaggttcag
aagaagtggcagcaatggcacctccgtgagttcccactgcaccccgtggcctccttcagc
aacagcaccaaggccagccacttggagcagagccagggcacctgcaggaccagcatcatc
tga

DBGET integrated database retrieval system