KEGG   Homo sapiens (human): 6344Help
Entry
6344              CDS       T01001                                 

Gene name
SCTR, SR
Definition
secretin receptor
Orthology
K04588  
secretin receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Bile secretion
Drug target
Secretin: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q14.1
AA seq 440 aa AA seqDB search
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTE
QPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPN
LACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMH
LFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYL
HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAF
SPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS
NSTKASHLEQSQGTCRTSII
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccacctgtcgccgccgctgcagcagctactactgccggtgctgctcgcctgc
gccgcgcactcgactggagcccttccccgactatgtgacgtgctacaagtgctgtgggaa
gagcaagaccagtgcctgcaggaactctccagagagcagacaggagacctgggcacggag
cagccagtgccaggttgtgaggggatgtgggacaacataagctgctggccctcttctgtg
ccgggccggatggtggaggtggaatgcccgagattcctccggatgctcaccagcagaaat
ggttccttgttccgaaactgcacacaggatggctggtcagaaaccttccccaggcctaat
ctggcctgtggcgttaatgtgaacgactcttccaacgagaagcggcactcctacctgctg
aagctgaaagtcatgtacaccgtgggctacagctcctccctggtcatgctcctggtcgcc
cttggcatcctctgtgctttccggaggctccactgcactcgcaactacatccacatgcac
ctgttcgtgtccttcatccttcgtgccctgtccaacttcatcaaggacgccgtgctcttc
tcctcagatgatgtcacctactgcgatgcccacagggcgggctgcaagctggtcatggtg
ctgttccagtactgcatcatggccaactactcctggctgctggtggaaggcctctacctt
cacacactcctcgccatctccttcttctctgaaagaaagtacctccagggatttgtggca
ttcggatggggttctccagccatttttgttgctttgtgggctattgccagacactttctg
gaagatgttgggtgctgggacatcaatgccaacgcatccatctggtggatcattcgtggt
cctgtgatcctctccatcctgattaatttcatccttttcataaacattctaagaatcctg
atgagaaaacttagaacccaagaaacaagaggaaatgaagtcagccattataagcgcctg
gccaggtccactctcctgctgatccccctctttggcatccactacatcgtcttcgccttc
tccccagaggacgctatggagatccagctgttttttgaactagcccttggctcattccag
ggactggtggtggccgtcctctactgcttcctcaatggggaggtgcagctggaggttcag
aagaagtggcagcaatggcacctccgtgagttcccactgcaccccgtggcctccttcagc
aacagcaccaaggccagccacttggagcagagccagggcacctgcaggaccagcatcatc
tga

DBGET integrated database retrieval system