KEGG   Homo sapiens (human): 6347Help
Entry
6347              CDS       T01001                                 

Gene name
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  
C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
Malaria
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6347 (CCL2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
  Infectious diseases
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex infection
    6347 (CCL2)
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    6347 (CCL2)
Cytokines [BR:hsa04052]
 Chemokines
  CC chemokine family
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   6347 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P13500(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 99 aa AA seqDB search
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

DBGET integrated database retrieval system