KEGG   Homo sapiens (human): 6352Help
Entry
6352              CDS       T01001                                 

Gene name
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Definition
chemokine (C-C motif) ligand 5
Orthology
K12499  
C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Prion diseases
Epithelial cell signaling in Helicobacter pylori infection
Chagas disease (American trypanosomiasis)
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Disease
H01358  
Atopic dermatitis
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6352 (CCL5)
  Neurodegenerative diseases
   05020 Prion diseases
    6352 (CCL5)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex infection
    6352 (CCL5)
   05142 Chagas disease (American trypanosomiasis)
    6352 (CCL5)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  6352 (CCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 154 aa AA seqDB search
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVHRSRMPKREGQQVWQDFLYDSRLNKGKLCHPKEPPSVCQPREEMGSGVHQLFGDELG
WRVLEPELTQICLFLLALVLAWEASPHYPTPPAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtccacaggtcaaggatgccaaagagagagggacagcaagtctggcaggatttc
ctgtatgactcccggctgaacaagggcaagctttgtcacccgaaagaaccgccaagtgtg
tgccaacccagagaagaaatgggttcgggagtacatcaactctttggagatgagctagga
tggagagtccttgaacctgaacttacacaaatttgcctgtttctgcttgctcttgtccta
gcttgggaggcttcccctcactatcctaccccacccgctccttga

DBGET integrated database retrieval system