KEGG   Homo sapiens (human): 6352Help
Entry
6352              CDS       T01001                                 

Gene name
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion diseases
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05323  Rheumatoid arthritis
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6352 (CCL5)
  Neurodegenerative diseases
   05020 Prion diseases
    6352 (CCL5)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex infection
    6352 (CCL5)
   05142 Chagas disease (American trypanosomiasis)
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   6352 (CCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Vega: OTTHUMG00000188396
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
PDB: 

Jmol
Position
17q12
AA seq 91 aa AA seqDB search
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system