KEGG   Homo sapiens (human): 6352Help
Entry
6352              CDS       T01001                                 

Gene name
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Definition
chemokine (C-C motif) ligand 5
Orthology
K12499  
C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Prion diseases
Epithelial cell signaling in Helicobacter pylori infection
Chagas disease (American trypanosomiasis)
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Disease
H01358  
Atopic dermatitis
H01360  
Allergic rhinitis
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 154 aa AA seqDB search
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVHRSRMPKREGQQVWQDFLYDSRLNKGKLCHPKEPPSVCQPREEMGSGVHQLFGDELG
WRVLEPELTQICLFLLALVLAWEASPHYPTPPAP
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtccacaggtcaaggatgccaaagagagagggacagcaagtctggcaggatttc
ctgtatgactcccggctgaacaagggcaagctttgtcacccgaaagaaccgccaagtgtg
tgccaacccagagaagaaatgggttcgggagtacatcaactctttggagatgagctagga
tggagagtccttgaacctgaacttacacaaatttgcctgtttctgcttgctcttgtccta
gcttgggaggcttcccctcactatcctaccccacccgctccttga

DBGET integrated database retrieval system