KEGG   Homo sapiens (human): 6354Help
Entry
6354              CDS       T01001                                 

Gene name
CCL7, FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Definition
(RefSeq) C-C motif chemokine ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6354 (CCL7)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    6354 (CCL7)
   04062 Chemokine signaling pathway
    6354 (CCL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6354 (CCL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 DUF4725
Motif
Other DBs
NCBI-GeneID: 6354
NCBI-ProteinID: NP_006264
OMIM: 158106
HGNC: 10634
Ensembl: ENSG00000108688
Vega: OTTHUMG00000132889
Pharos: P80098(Tbio)
UniProt: P80098
Structure
PDB: 

Jmol
Position
17q12
AA seq 99 aa AA seqDB search
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctctgcagcacttctgtgtctgctgctcacagcagctgctttcagcccccag
gggcttgctcagccagttgggattaatacttcaactacctgctgctacagatttatcaat
aagaaaatccctaagcagaggctggagagctacagaaggaccaccagtagccactgtccc
cgggaagctgtaatcttcaagaccaaactggacaaggagatctgtgctgaccccacacag
aagtgggtccaggactttatgaagcacctggacaagaaaacccaaactccaaagctttga

DBGET integrated database retrieval system