KEGG   Homo sapiens (human): 6355Help
Entry
6355              CDS       T01001                                 

Gene name
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Definition
(RefSeq) C-C motif chemokine ligand 8
  KO
K16596  C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6355 (CCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 DUF4725
Motif
Other DBs
NCBI-GeneID: 6355
NCBI-ProteinID: NP_005614
OMIM: 602283
HGNC: 10635
Ensembl: ENSG00000108700
Vega: OTTHUMG00000132883
Pharos: P80075(Tbio)
UniProt: P80075
Structure
PDB: 

Jmol
Position
17q12
AA seq 99 aa AA seqDB search
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

DBGET integrated database retrieval system