KEGG   Homo sapiens (human): 6355Help
Entry
6355              CDS       T01001                                 

Gene name
CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8
Definition
chemokine (C-C motif) ligand 8
Orthology
K16596  
C-C motif chemokine 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6355 (CCL8)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6355 (CCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 99 aa AA seqDB search
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttctgcagcgcttctgtgcctgctgctcatggcagccactttcagccctcag
ggacttgctcagccagattcagtttccattccaatcacctgctgctttaacgtgatcaat
aggaaaattcctatccagaggctggagagctacacaagaatcaccaacatccaatgtccc
aaggaagctgtgatcttcaagaccaaacggggcaaggaggtctgtgctgaccccaaggag
agatgggtcagggattccatgaagcatctggaccaaatatttcaaaatctgaagccatga

DBGET integrated database retrieval system