KEGG   Homo sapiens (human): 6364Help
Entry
6364              CDS       T01001                                 

Gene name
CCL20, CKb4, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38
Definition
chemokine (C-C motif) ligand 20
Orthology
K14625  
C-C motif chemokine 20
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    6364 (CCL20)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6364 (CCL20)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6364 (CCL20)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    6364 (CCL20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q36.3
AA seq 95 aa AA seqDB search
MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDIN
AIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgtaccaagagtttgctcctggctgctttgatgtcagtgctgctactccacctc
tgcggcgaatcagaagcaagcaactttgactgctgtcttggatacacagaccgtattctt
catcctaaatttattgtgggcttcacacggcagctggccaatgaaggctgtgacatcaat
gctatcatctttcacacaaagaaaaagttgtctgtgtgcgcaaatccaaaacagacttgg
gtgaaatatattgtgcgtctcctcagtaaaaaagtcaagaacatgtaa

DBGET integrated database retrieval system