KEGG   Homo sapiens (human): 6366Help
Entry
6366              CDS       T01001                                 

Gene name
CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Definition
chemokine (C-C motif) ligand 21
Orthology
K16062  
C-C motif chemokine 21
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 134 aa AA seqDB search
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcactggctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgttgcctcaagtacagccaaaggaagatt
cccgccaaggttgtccgcagctaccggaagcaggaaccaagcttaggctgctccatccca
gctatcctgttcttgccccgcaagcgctctcaggcagagctatgtgcagacccaaaggag
ctctgggtgcagcagctgatgcagcatctggacaagacaccatccccacagaaaccagcc
cagggctgcaggaaggacaggggggcctccaagactggcaagaaaggaaagggctccaaa
ggctgcaagaggactgagcggtcacagacccctaaagggccatag

DBGET integrated database retrieval system