KEGG   Homo sapiens (human): 6368Help
Entry
6368              CDS       T01001                                 

Gene name
CCL23, CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
Definition
chemokine (C-C motif) ligand 23
Orthology
K05511  
C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6368 (CCL23)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6368 (CCL23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 137 aa AA seqDB search
MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDMLWRRKIGPQMTLSH
AAGFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQ
VCMRMLKLDTRIKTRKN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttactgcccttggatcccag
gcccgggtcacaaaagatgcagagacagagttcatgatgtcaaagcttccattggaaaat
ccagtacttctggacatgctctggaggagaaagattggtcctcagatgaccctttctcat
gctgcaggattccatgctactagtgctgactgctgcatctcctacaccccacgaagcatc
ccgtgttcactcctggagagttactttgaaacgaacagcgagtgctccaagccgggtgtc
atcttcctcaccaagaaggggcgacgtttctgtgccaaccccagtgataagcaagttcag
gtttgcatgagaatgctgaagctggacacacggatcaagaccaggaagaattga

DBGET integrated database retrieval system