KEGG   Homo sapiens (human): 637Help
Entry
637               CDS       T01001                                 

Gene name
BID, FP497
Definition
BH3 interacting domain death agonist
Orthology
K04726  
BH3 interacting domain death agonist
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Tuberculosis
Pathways in cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    637 (BID)
   04115 p53 signaling pathway
    637 (BID)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    637 (BID)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    637 (BID)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    637 (BID)
   05014 Amyotrophic lateral sclerosis (ALS)
    637 (BID)
  Cardiovascular diseases
   05416 Viral myocarditis
    637 (BID)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    637 (BID)
  Infectious diseases
   05152 Tuberculosis
    637 (BID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.1
AA seq 195 aa AA seqDB search
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgaggtcaacaacggttccagcctcagggatgagtgcatcacaaacctactg
gtgtttggcttcctccaaagctgttctgacaacagcttccgcagagagctggacgcactg
ggccacgagctgccagtgctggctccccagtgggagggctacgatgagctgcagactgat
ggcaaccgcagcagccactcccgcttgggaagaatagaggcagattctgaaagtcaagaa
gacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagc
atccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggag
gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaga
gacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggcc
agtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccag
aacctacgcacctacgtgaggagcttagccagaaatgggatggactga

DBGET integrated database retrieval system